KEGG   Gallus gallus (chicken): 395142Help
Entry
395142            CDS       T01006                                 

Gene name
ITGB5
Definition
(RefSeq) integrin beta-5 precursor
  KO
K06588  integrin beta 5
Organism
gga  Gallus gallus (chicken)
Pathway
gga04145  Phagosome
gga04510  Focal adhesion
gga04512  ECM-receptor interaction
gga04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    395142 (ITGB5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    395142 (ITGB5)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    395142 (ITGB5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    395142 (ITGB5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    395142 (ITGB5)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:gga04515]
    395142 (ITGB5)
Membrane trafficking [BR:gga04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    395142 (ITGB5)
Cell adhesion molecules [BR:gga04515]
 Integrins
  Integrin beta subunits
   395142 (ITGB5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta Integrin_B_tail Integrin_b_cyt PSI_integrin EGF_2 I-EGF_1
Motif
Other DBs
NCBI-GeneID: 395142
NCBI-ProteinID: NP_989814
CGNC: 8937
Ensembl: ENSGALG00000029766
UniProt: Q6T683
LinkDB All DBs
Position
7
AA seq 812 aa AA seqDB search
MPRRGGLPAPAAARRPPPLLRLLLRLLLLAAPLQPGRGLNLCTSGSASSCEECLLIHPKC
AWCSKEEFGSTKSVPSRCDFLKNLIANGCAGAIENPRSSSSVAKNVPLSSKGSGQTHLDV
TQITPQKVALSLRPGDRTSFRVQVRQVEDYPVDLYYLMDLSLSMNDDLDNIRNLGTKLAE
EMRKLTSNFRLGFGSFVDKNISPFSYTAPRYQNNPCIGYKLFPSCVPSFGFRHLLSLTDK
VDRFNEEVQKQKVSRNRDAPEGGFDAILQAAVCKEKIGWRKEASHLLVFTTDDVPHIALD
GKLGGLVQPHDGQCHLNEANEYSASSQLDYPSLALLGEKLAENNIHLIFAVTKSHYVLYK
NFTALIPGTTVEILHKDSKNIIELIVKAYNSIRSKVELTVWDSPEDIGLTFTATCQDGLS
YPGLRKCGDLKIGDTVSFEVSVEARSCPAEDTSHVFTIKPAGFRDTLEVTVTYNCLCGCT
GLAEPASGKCSGNGTYACGLCECDAGYLGARCECEEGAGGETQPGLCREVEGKPVCSGRG
ECSCNQCVCYESEFGNIYGPFCECDDFSCARYKGVLCSGHGECHCGECKCHTGYIGDNCN
CSTETASCVSSDGQMCSGRGNCICGRCQCTEPGAFGETCEKCPTCPGVCSTKRDCIECKL
FNSGRLDNQTCQKHCKDELITTVDVLKTDDPNAILCAYPVNNCVMKFTYSELASGKSNLT
VLKEPACSSAPSAVTIVLAVIGSVVLIGTILLGLWKLLVTIHDRREFDRFQSERTRARYE
MASNPLYRKPISTHNVEFTFNKLNKSYNGTVD
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atgccccgccgaggggggctgccggcccccgccgccgcccgccggccccccccgctcctc
cgcctcctcctccgcctcctcctcctggccgccccgctgcagcccggcagaggtctcaac
ctgtgcacgagtggaagcgcctcatcctgcgaagagtgtctcctcatccatcccaaatgt
gcgtggtgctccaaagaggagttcggcagcacgaagtccgtcccatcgcggtgcgacttc
ctgaagaacctcattgccaacggttgcgccggagccatcgagaacccgcgcagcagcagc
agcgtggcgaagaacgtccccttgagcagcaagggctctgggcagacccacctggatgtc
acacagatcaccccgcagaaggtcgccctgagtcttcgtcctggtgaccggacttccttc
cgagttcaggtccggcaagtggaggactatcccgtggacctgtactacctgatggatctc
tccctgtccatgaacgacgacctggacaatattcgcaatctggggaccaagctggctgaa
gagatgcgaaagctcactagcaatttccggctgggttttggctcttttgtggacaaaaac
atttctcctttctcctacacggcaccgagataccaaaacaatccctgcattggctataag
ctgttcccaagctgcgtcccctcctttggtttccgccacctcttgtccctgacggacaaa
gttgaccgttttaatgaagaagtgcagaagcagaaggtgtcccggaacagggatgcccca
gagggcggtttcgatgcaattttgcaggctgctgtgtgcaaggagaagatcggctggcga
aaggaggcatcccacctgctggtcttcaccacagacgatgtgccccacatagctctggat
gggaagctggggggcctggtgcagccccatgatggccagtgccacctgaacgaggccaat
gagtacagcgcgtccagccagctggattacccttccctggcactccttggggagaaactg
gctgaaaacaacatccacctgatattcgctgttacaaaaagccactatgtcctgtacaag
aacttcactgctttgattcctgggaccacagtggagattttgcataaggactccaagaat
atcatcgagctgatcgtcaaggcctacaacagcattcggtccaaagtagaactcactgtc
tgggacagccctgaggacattggcttgaccttcactgccacctgccaggatggattgtcc
tatcctgggctcagaaaatgtggagatctcaagataggagatacggtttccttcgaggtg
tcggtggaggcccgcagctgcccggctgaggacacttcccacgtcttcaccatcaagcca
gccggcttccgtgacacactggaggtgactgtcacctacaactgcctgtgtggctgcacc
ggcctcgcggagccagccagcggcaagtgcagcggcaatgggacctatgcctgcgggctg
tgcgagtgcgatgccggctacctgggggcccgctgtgaatgtgaggagggggccggcggg
gagacccagcccgggctgtgccgtgaggtggagggaaagcccgtctgcagcgggcggggg
gaatgcagctgtaaccagtgcgtctgctatgagagcgagttcgggaacatctacgggccc
ttctgcgagtgtgatgacttctcctgcgctcgatacaagggagtcctctgctcaggccat
ggagagtgtcactgtggggagtgcaagtgccacacaggctacatcggggacaactgcaac
tgttccaccgagactgccagctgtgtctccagcgatgggcagatgtgcagcggccgcggc
aactgcatctgtgggaggtgccagtgcaccgagcccggggcgtttggggagacctgtgag
aagtgtcccacctgcccaggggtctgcagcaccaaaagggactgcattgaatgcaagctg
tttaactcaggaagactggataaccaaacctgccaaaagcactgcaaggatgagctcatc
accaccgtggatgttctcaaaacggatgaccccaatgcgatcctatgtgcctacccagtg
aacaactgcgtcatgaagttcacctactcagagctcgccagtgggaagtccaacctcacc
gtcctcaaggagccagcatgcagctcagcccccagtgccgtgaccattgtgctggctgtc
atcggcagcgtggtgctgattggcaccatcctgctggggctctggaagctgctcgtcacc
attcacgacaggagggagttcgaccgattccagagcgaacgtacgcgggcgagatacgaa
atggcatccaatcctctctaccgaaagcccatttctacgcataacgtagagttcacattc
aacaagctcaacaaatcttacaacggtacagttgactga

DBGET integrated database retrieval system