KEGG   Gallus gallus (chicken): 395277Help
Entry
395277            CDS       T01006                                 

Gene name
PARK7
Definition
(RefSeq) protein/nucleic acid deglycase DJ-1
  KO
K05687  protein DJ-1 [EC:3.5.1.124]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:gga01002]
    395277 (PARK7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    395277 (PARK7)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.124  protein deglycase
     395277 (PARK7)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   395277 (PARK7)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   395277 (PARK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DJ-1_PfpI GATase_3
Motif
Other DBs
NCBI-GeneID: 395277
NCBI-ProteinID: NP_989916
CGNC: 66200
Ensembl: ENSGALG00000036214
UniProt: Q8UW59
LinkDB All DBs
Position
21
AA seq 189 aa AA seqDB search
MASKRALVILAKGAEEMETVIPTDVMRRAGIKVTVAGLTGKEPVQCSRDVLICPDASLED
ARKEGPYDVIVLPGGNLGAQNLSESAAVKDILKDQESRKGLIAAICAGPTALLAHGIGFG
SKVITHPLAKDKMMNGAHYCYSESRVEKDGNILTSRGPGTSFEFGLAIVEALMGKEVAEQ
VKAPLILKD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgaaaagagcgttggtgattctggcgaaaggggcagaggaaatggaaactgtc
atccccactgatgttatgagaagagctgggatcaaggtgactgttgcaggcctaactgga
aaagaaccagtgcagtgtagccgagatgtcctcatttgtcctgatgccagtctagaggat
gccagaaaagagggaccttacgatgtcattgtcctgcctggaggtaaccttggagctcag
aacttgtcagagtctgctgctgttaaagacattttgaaggatcaggaaagcagaaaaggc
ctgattgctgctatatgcgcaggtcccactgcccttctggcacatgggataggatttgga
agcaaagtcataacgcatcctttggccaaagataaaatgatgaatggagctcactactgc
tactccgagagccgtgtggagaaagatgggaacatcctcaccagccgtggccctggtacc
agctttgagtttgggttggccattgttgaagcactgatggggaaggaagtggctgaacaa
gtgaaggcaccactaatattgaaagactga

DBGET integrated database retrieval system