KEGG   Gallus gallus (chicken): 395509
Entry
395509            CDS       T01006                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha precursor
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04020  Calcium signaling pathway
gga04144  Endocytosis
gga04510  Focal adhesion
gga04540  Gap junction
gga04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    395509 (PDGFRA)
   04020 Calcium signaling pathway
    395509 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    395509 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    395509 (PDGFRA)
   04540 Gap junction
    395509 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    395509 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    395509 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:gga04090]
    395509 (PDGFRA)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     395509 (PDGFRA)
Protein kinases [BR:gga01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   395509 (PDGFRA)
CD molecules [BR:gga04090]
 Proteins
  395509 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE Adeno_E3_CR1
Other DBs
NCBI-GeneID: 395509
NCBI-ProteinID: NP_990080
CGNC: 10416
Ensembl: ENSGALG00000013929
UniProt: F1N870
LinkDB
Position
4
AA seq 1087 aa
MGTPPRTFLILGCFLTGPLLTLCQLPLPTIVPNRNEMVVQLNSNFTLKCSGDSEVSWQYP
VTEGSHRIDIRHEENNSGLFMTVLEVGNASAAHTGMYVCYYNHTQVEDGEVEGKDIYIYV
PDPDMPFVPSLPEDQFILVEEGDPTVIPCRTSDPSAEVTLVNSLDKPVYAFYDSKQGFVG
NFLAGPYTCKTMVKGVEFKSDEFLIYILRATSQLPVEIEALKTVYKTGETIVVTCVVFDN
EVVNLQWNYPGKVKEKGLIKLDDIKVPSQKLVYTLTIPDASVKDTGDYECTARHATKEVK
ENKKVVITVHDKGFIHLEPQFSPLEAVNLHEVKNFVVDVQAYPAPKMYWLKDNVTLIENL
TEIVTSSNRVQETRFQSVLKLIRAKEEDSGYYTLVAENEDEIKRYTFSLLIQVPALILDL
MDDHQGSAGRQTVRCLAEGTPLPDVEWLVCKDIKKCSNDTSWTLLTNNISDIHMEAHLDE
RNMVESQVTFQKVEETLAVRCVARNDLGAVTRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLSRHPEKPKKDLDIFGMNPADESTRSY
VILSFENTGEYMDMKQADTTQYVPMLERKEGSKYSDIQRSVYDRPASYKKKSLSESEVKN
LLSDDGSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATNEVYEIMVKCWNSEPEKRPSFYHLSEIVESLLPGEYKK
SYEKIHLDFLKSDHPAVTRMRGDCDNAYIGVTYKNEDKIKDRESGFDEQRLSADSGYIIP
LPDIDPVSEDELGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSSD
LVEDSFL
NT seq 3264 nt   +upstreamnt  +downstreamnt
atgggtactcccccaaggacgttcctgatcctgggatgttttctcacaggaccgctccta
acactttgccagcttcctctgccgactattgttcccaatagaaatgagatggttgtacag
ctgaattccaatttcacactcaaatgctctggagacagcgaagtgagctggcagtacccg
gtgaccgagggaagccacaggatagacatcagacacgaggagaacaacagtggcctcttc
atgacagtgcttgaagtcggaaatgcctcagccgctcacacgggcatgtatgtttgctat
tataaccacacgcaagtggaggatggggaagtcgaggggaaggacatctacatctatgtg
cctgacccagacatgccttttgttccttccttaccagaagaccagttcatcctagtagaa
gaaggtgatcccactgttatcccttgtcggacaagtgacccaagtgctgaagtgacttta
gttaacagtttagacaagcctgtctatgctttctatgacagcaaacagggcttcgtaggg
aacttccttgcaggaccatacacatgcaaaacaatggttaaaggcgtggagttcaagtcc
gatgagttcctcatctatattttaagagctacttcacagctgccggttgaaattgaagct
ctgaaaactgtctacaaaacaggcgagaccatcgtagtaacttgtgtggtctttgacaat
gaggtggttaatttacagtggaattatcctgggaaagtgaaagaaaaaggtctgataaaa
cttgatgatatcaaagtcccatcacagaagttggtttacacgttgaccatacctgacgca
tcagtgaaagacacaggggattatgaatgtactgcccgacatgcaaccaaggaggttaag
gaaaataagaaagtagtcattacagttcatgacaaagggttcattcatctagagcctcaa
tttagccctttggaagctgtcaatctacatgaagtcaaaaattttgtcgtcgatgtgcag
gcgtaccccgctccaaaaatgtactggttgaaggataatgtgactctgattgaaaacctt
actgagattgttactagttcaaacagagtccaggaaacacggtttcaaagtgtactaaaa
ttgatccgggccaaggaagaagacagtgggtactatactttggttgctgaaaatgaagat
gagattaagagatacaccttctcgttgctaatacaagttccagccttgatcttagacctc
atggacgaccaccaaggctctgctggcaggcagacggtgaggtgcttggctgaaggtacc
ccgcttcctgatgtggaatggttggtttgcaaggacattaaaaaatgcagcaatgacact
tcctggactcttctgactaacaacatctctgatatacacatggaagcccacctggatgag
aggaatatggtggaaagccaggtgaccttccagaaggtagaagaaaccctggctgtgaga
tgtgtagcaagaaatgaccttggagctgttactcgggaactgaaacttgtggctcccacc
ttgcgatcagaactgacggtggctgctgctgtcttagtactgctggtgattgtgataatt
tcactgattgtcctggtcatcatctggaaacagaagccaaggtatgagataagatggaga
gtcattgagtctatcagccccgatggccatgaatacatttatgtggacccaatgcagcta
ccttatgactccagatgggagtttcctcgagatgggctagtgcttggtcgaatccttggt
tctggtgcatttggaaaagtggtggaagggacagcatatggattgagtcgttctcaacct
gtgatgaaagtagccgtgaaaatgctgaaacctacagctagatccagcgaaaaacaggcg
ctcatgtctgaactgaagataatgacacatcttgggccccacctgaatattgtgaacctg
cttggagcttgtacgaaatcaggtcctatttacataatcactgaatactgcttttacggt
gatttggtgaactatctgcacaagaacagggacaacttcctcagccgacatccagagaaa
ccaaagaaagatctggatatttttgggatgaacccagctgatgaaagcacaagaagctat
gtgattttatcatttgaaaacaccggagaatatatggatatgaaacaagctgataccact
cagtatgtgccaatgctggaaaggaaggagggatctaaatactctgatattcagagatct
gtatatgatcgacctgcttcatataagaagaaatctttgtcagaatcagaagtaaaaaac
cttctttcagatgacggttcggagggtctaagcctactggatttgctaagcttcacctac
caggttgcacggggaatggaattcttggcttctaaaaattgcgtacaccgtgacttggca
gctcgtaatgtccttctggctcaaggcaaaatcgtgaagatctgcgactttgggttggct
agagacatcatgcatgattccaactatgtctccaagggcagcaccttcctcccagtaaaa
tggatggcacctgaaagcatttttgacaatctgtacacaacattaagtgatgtctggtct
tatggcattctgctgtgggaaatattttctcttggtggcacaccatatcctggcatgatg
gtcgactccaccttctacaataagataaagagtggctaccgaatggcaaaacctgatcat
gctaccaatgaagtgtatgagatcatggtaaagtgctggaacagtgaaccagagaaaaga
ccttcgttttaccatctgagtgaaattgtggagagcttgttgcctggagagtacaaaaag
agctacgagaagattcacctggacttcctgaaaagcgatcacccagctgtcactcgaatg
agaggggactgtgacaatgcttacattggtgtcacctacaagaatgaagacaagataaag
gatagagagagtggatttgatgagcagaggctgagtgctgacagtgggtacatcatcccc
ctgcctgacattgaccctgtttctgaagatgagcttggcaaaaggaacaggcacagttcc
cagacatctgaagagagtgccattgaaaccggttccagtagctctacctttataaagaga
gaggatgagaccattgaggacattgacatgatggatgacattggaattgactcctcggat
cttgtagaggacagcttcctgtaa

DBGET integrated database retrieval system