KEGG   Gallus gallus (chicken): 395758Help
Entry
395758            CDS       T01006                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00020  Citrate cycle (TCA cycle)
gga00190  Oxidative phosphorylation
gga01100  Metabolic pathways
gga01200  Carbon metabolism
Module
gga_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gga_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
gga_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    395758 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    395758 (SDHA)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     395758 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 395758
NCBI-ProteinID: NP_001264327
CGNC: 49461
Ensembl: ENSGALG00000013167
UniProt: Q9YHT1 F1NPJ4
LinkDB All DBs
Structure
PDB: 

Position
2
AA seq 665 aa AA seqDB search
MAAVVAASRSLAKCWLRPAVRAWPAACQTHARNFHFTVDGKKNASTKVSDSISTQYPVVD
HEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEDDNW
RWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVIELENYGMPFSRTEEGKIYQRAFGGQSLQ
FGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCI
EDGTIHRFRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTG
IYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGCGP
EKDHVYLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKG
QVITHVNGEDKVVPGLYACGEAASASVHGANRLGANSLLDLVVFGRACALTIAETCKPGE
PVPSIKPNAGEESVANLDKLRFADGTIRTSEARLNMQKTMQSHAAVFRTGSILQEGCEKL
SQIYRDLAHLKTFDRGIVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKL
RIDEFDYSKPLQGQQKRPFEEHWRKHTLSYVDVKSGKVTLKYRPVIDRTLNEEDCSSVPP
AIRSY
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggtggcagcgtcgcgcagcttggctaagtgttggctgcggccagcggtg
cgggcgtggccagcagcatgccagactcatgcacgcaactttcacttcacagttgatgga
aagaaaaatgcttctaccaaagtttctgattcgatttctacacaatatccagttgtggac
catgagtttgatgcagttgttgtgggtgcaggaggagcaggcctgcgggctgcatttggt
ttgtccgaggctgggtttaatacagcatgtgttacaaagctgtttcccaccaggtctcat
actgttgctgcgcagggagggatcaatgcagctttgggaaacatggaagatgacaactgg
aggtggcatttctatgacacagtgaaaggatctgactggctgggtgaccaggatgccata
cattacatgactgagcaagccccagctgcagtgatagagctggaaaactatgggatgcca
ttcagtagaacagaggaaggaaaaatctaccagcgtgcatttggtggacagagtcttcag
tttggaaaaggaggacaggctcacagatgctgttgtgttgctgacaggacaggacactcg
ctcttgcatactctgtatggcaggtctctaagatatgataccagctactttgttgaatat
tttgccttggacctgctgatggaaaacggagaatgtcgtggtgttattgctctttgcata
gaagatggcactatacatcgttttagagcaaagaacactgtcattgccactggggggtat
ggccgtacttacttcagctgtacatctgctcacactagtacaggtgatggcactgctatg
gttacacgagctggccttccttgccaggacttggagtttgtacagtttcaccctacaggt
atctatggggctggctgcctcataacagaaggatgtcgtggagagggaggtattctaatt
aacagtcaaggtgaaaggtttatggagagatatgcacctgtagctaaagatctggcttcc
agggatgtagtgtctcgttctatgaccatagagatacgggaaggaaggggttgtggccct
gaaaaagatcatgtgtacttgcagttgcaccatttaccaccccagcagctggcaactcgt
ctcccagggatttcagaaacagctatgatatttgctggagttgatgtcactaaggagcct
attcccgttttgcctacggtgcattataatatgggaggtattcctactaactacaaggga
caggtgatcacgcatgtgaatggtgaggataaggtggtacctggcttatatgcttgtggc
gaggcagcgtctgcatctgtccatggtgctaatcgtcttggagcaaactcccttttggat
ctggtggtctttggtcgtgcttgtgcccttactattgcagagacctgcaagcctggagaa
ccagtcccctccattaaaccaaatgctggtgaagaatcagttgctaatcttgataaatta
agatttgctgatggaacgataaggacttcagaagcacgacttaatatgcagaagacaatg
caaagccatgctgctgtatttcgtactggctctatactacaagaaggctgtgaaaaactt
agccaaatttatcgtgatctggctcatctaaagacatttgacagaggcattgtgtggaac
accgatttggtggagacccttgaactgcaaaacctgatgctttgtgccctgcaaaccatt
tatggtgctgaggctcgcaaagagtcccgaggtgctcatgccagagaggactataagtta
cggatagatgagtttgactattctaagccactccaaggccaacagaagaggccatttgaa
gagcactggaggaagcacaccctttcgtatgtggatgtcaagtcggggaaggttaccttg
aaatacagacctgtaattgacagaactttgaacgaagaagactgttcaagtgttccacct
gctattcgctcatactag

DBGET integrated database retrieval system