KEGG   Gallus gallus (chicken): 395807
Entry
395807            CDS       T01006                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00220  Arginine biosynthesis
gga00330  Arginine and proline metabolism
gga01100  Metabolic pathways
gga04020  Calcium signaling pathway
gga04146  Peroxisome
gga04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    395807 (NOS2)
   00330 Arginine and proline metabolism
    395807 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    395807 (NOS2)
   04020 Calcium signaling pathway
    395807 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    395807 (NOS2)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     395807 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6 DUF1400
Other DBs
NCBI-GeneID: 395807
NCBI-ProteinID: NP_990292
CGNC: 49489
Ensembl: ENSGALG00000038096
UniProt: Q90703
LinkDB
Position
19
AA seq 1136 aa
MLCPWQFAFKPHAVKNQSSEEKDINNNVEKDVKVHSFVKDDAKLHSLSKKQMKMSPIITS
AEKHPQNGIKASNQISRCPRHVKVRNMENGSSLLDTLHLTAKEVINCRTRACQGALMTPK
GLVRSTRDGPVPPAELLPQAVDFVKQYYSSFKELKIEEHLARLETVTKEIETTGTYHLTK
DELIFAAKQAWRNAPRCIGRIQWSNLQVFDARDCKTAKEMFEYICRHIQYATNNGNIRSA
ITIFPQRTDGKHDFRVWNSQLIRYAGYQMPDGSVIGDPASVEFTKLCIELGWKPKYGRFD
VVPLILQANGQDPEIFEYPPEIILEVPMEHPKYEWFKELDLKWYALPAVANMLLEVGGLE
FTACPFNGWYMGTEIGVRDFCDVQRYNILKEVGRRMGLESNKLASLWKDRAVVEINVAVL
HSFQKQNVTIMDHHSAAESFMKYMQNEYRVRGGCPADWVWIVPPMSGSITPVFHQEMLNY
VLTPFFYYQVDAWKTHIWHDETRRPKKREIKLSILAKAVLLASLLLQKTMAARPKVTVIY
ATETGKSETLANSLCSLFSCAFNTKILCMDEYNISDLEKETLLLVVTSTFGNGDSPNNGK
TLKNSLLTLKLLRKNIRYAVFGLGSTMYPEFCAFAHAIDQKLSQLGALQLTPVGEGDELN
GQEEAFRTWAVTAFKTACDIFDIRGKNSIQLPEIYTSDDSWNPKKHRIVYDSQTMDLTKA
LSDIHGKNVIPMKLKFRQNLQSLKSSRVTILVKLSCETNQEVHYLPGEHIGISPGNQPEL
VHGLIARVKDAPPADQTIRLETCTEGGYWASEKKIPACTLSQALTYLLDITTPPTQQLLK
KLSQLVTAEGDKQRLEVLCHSTEEYNKWKFYNRPNILEVLEEFPSAEVSTAFLLTQLPLL
KPRYYSVSSSCDMTPREIHLTVAVVNYRTRDGQGPLHHGVCSTWLNKIALNETVPCFVRS
ADGFRLPKEPAKPCILIGPGTGIAPFRSFWQQRLYDLEKKGIKGGDMILLFGCRHPDMDH
IYKEEVEEMKRKGVLKEVFTAYSRQPGQPKVYVQDILQNELETKVCNILHKEEGHLYVCG
DVRMARDVAQTLKRMLVKKLNHTEQQAEEYFFQLKSQKRYHEDIFGAVFPHEVKRI
NT seq 3411 nt   +upstreamnt  +downstreamnt
atgctgtgcccatggcagtttgcattcaaacctcatgctgttaagaaccagtcctctgaa
gagaaggatatcaataataacgtggagaaagatgtgaaggtccacagctttgtgaaagat
gatgccaaattacacagtctaagcaagaagcagatgaagatgtcacctataatcacttca
gcagagaaacacccacaaaatggtatcaaagcttctaaccaaatatcaagatgtcctaga
catgtaaaagtaaggaacatggaaaatggatccagccttctagacacattacacctgaca
gcaaaggaggttatcaattgtcggaccagagcttgccaaggagcactcatgaccccaaag
ggcctggtgagaagcactagagatgggccagttcctccagcagagcttctacctcaagca
gtagactttgtcaagcagtactacagttcattcaaagaattaaaaatagaagagcacctg
gcccgactagaaacagtgaccaaagagatagaaacaacaggaacctaccatctgacaaag
gatgaactgatctttgctgccaaacaggcctggaggaatgctccaagatgtattgggaga
atccagtggtccaatctacaggtatttgatgctcgtgattgtaaaacagccaaggaaatg
tttgaatatatctgtcgccatattcagtatgccacaaacaatggaaatataagatcagcc
atcaccattttccctcagaggactgatgggaaacatgatttccgtgtttggaacagccag
ctcatccgatatgctggatatcaaatgccagatgggtctgtcataggagaccctgcaagt
gtggagttcacaaagttgtgcattgagcttgggtggaagccgaaatatggccgctttgat
gtagttccactcattctccaagcaaacggccaagatccagaaatatttgaatacccgcca
gagattatccttgaagtgccaatggagcatccaaaatatgagtggtttaaggagttggat
ctgaagtggtatgctctgcctgctgttgccaacatgctccttgaggtgggaggtctggaa
tttactgcgtgtcctttcaacggctggtacatgggaacagagattggagtgcgagacttc
tgtgatgtacagcggtacaatatcctgaaggaggttggaagaagaatgggactggaaagc
aacaaacttgcatcattgtggaaggaccgagctgttgtagagataaatgtggctgtgctt
catagcttccagaaacaaaatgttactataatggatcatcactcagctgctgagtccttc
atgaaatacatgcagaatgagtaccgtgtgcgaggaggctgcccagctgattgggtgtgg
attgtacctcctatgtcggggagcataactcccgtgttccaccaggagatgttgaactat
gtcctcactcccttcttttactaccaggtggatgcatggaaaacacacatctggcatgat
gagacccgtaggccaaagaaaagagaaataaagttgagcattttggccaaggctgtactc
ttggcgtcattactcctgcaaaaaacaatggcagccaggcccaaggtgactgtgatctat
gcaaccgagactgggaaatcagaaacattagccaacagtctgtgcagtttgtttagctgt
gccttcaacactaagattctgtgcatggatgagtacaacatcagtgacttggaaaaagaa
acacttcttttagtggttactagcacttttggaaatggagattctccaaataatggaaag
acgttgaagaactccttgctcaccctgaaattactgagaaaaaatattagatatgctgtg
tttggtttggggtccaccatgtatcctgagttctgtgcctttgctcatgccattgaccag
aaactgtcccaactgggggctttgcagctcactccagtgggtgaaggagatgaactcaat
ggtcaagaagaagcctttcgcacatgggcagtcactgcattcaagactgcctgtgatatt
tttgacatccgtgggaaaaacagtattcagttacctgagatatacacatcagatgacagc
tggaatcctaagaaacataggatagtatatgactctcaaacaatggacttgactaaagca
ctgtcagacattcatggaaagaacgtaattcccatgaagctgaaattcagacagaatctt
cagagtttgaaatccagtcgtgttaccattctagttaagctttcctgtgagactaatcag
gaagtgcactacctgcctggagaacatattgggatttccccaggcaaccagccagaatta
gtccacggcctcattgcacgtgttaaggatgcccctccagctgatcagactatcagactt
gaaacctgtactgaaggtggctattgggcaagcgagaaaaagattccggcttgcacactc
tcacaggccttgacatatttacttgatatcactaccccacccacccaacaactgctaaaa
aaactctcccagctggtaacagcggaaggagacaaacagagactggaagttttatgtcat
agcacagaagaatacaataaatggaagttttacaacaggccaaacatcctggaggtcctg
gaagagtttccttctgctgaagtctcaacagctttcttactgactcagctgccacttctg
aaacccaggtactactctgtcagttcctcctgtgacatgacacccagagagattcatctg
accgttgcagtggtaaactacaggacaagagatggacaagggccattgcaccatggagtc
tgcagcacgtggctgaacaaaatagctctcaatgaaacagtcccgtgctttgtgcgcagc
gctgatggattccggctcccaaaggagccagccaagccgtgcattcttattggcccagga
acaggaattgctccattcagaagtttctggcagcagcgtctctatgacttggaaaagaaa
gggatcaaaggtggtgacatgatattactgtttggctgccggcatccagatatggatcat
atctacaaagaagaagttgaagaaatgaagaggaaaggagttctgaaagaagtttttaca
gcttactccaggcaacctgggcagcctaaagtctatgttcaagatattcttcaaaatgag
ttggaaaccaaagtgtgtaatatcttgcataaagaggaagggcatctgtatgtctgtgga
gatgtacgcatggccagggatgttgctcagactttgaagaggatgcttgtaaaaaaactg
aaccacacagagcagcaggcagaagagtatttcttccagctaaagagccaaaagcgatac
catgaagacatatttggggctgtgttcccacatgaagtcaaaagaatataa

DBGET integrated database retrieval system