KEGG   Gallus gallus (chicken): 395891
Entry
395891            CDS       T01006                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04020  Calcium signaling pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
gga04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    395891 (CACNA1C)
   04020 Calcium signaling pathway
    395891 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    395891 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    395891 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    395891 (CACNA1C)
   04270 Vascular smooth muscle contraction
    395891 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    395891 (CACNA1C)
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   395891 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH CAC1F_C PKD_channel DUF4834
Other DBs
NCBI-GeneID: 395891
NCBI-ProteinID: XP_015141927
CGNC: 49535
Ensembl: ENSGALG00000013022
LinkDB
Position
1
AA seq 2202 aa
MFQAFVRQAYQPLSSHQQGESETKYRGKLVHETQLNCFYIKPGGSNYGSPRPAHANMNAN
AAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTASSTQRKRQQYGKQKKQG
TTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSN
ATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILE
QATKADGGNSIGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIAL
LVLFVIIIYAIIGLELFMGKMHKTCYHVQGGLIDTPAEDDPSPCAPQSAHGRQCQNGTEC
KAGWEGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFG
SFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENE
DEGMDEEKPRNRSTPAGLPDKKKEKFSWFSHSTETHVSMPTSETESVNTDNVPGTDIEGE
NCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYN
QPDWLTEVQDTANKVLLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVE
TKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSL
LGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGM
LVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKK
QEIEKTAVEEETKEEKIELKSITADGESPPATKINMDDYQPNENEEKSPYPTTEAPAEED
EEEPEMPVGPRPRPMSELHLKEKAVPMPDASAFFIFSPNNRFRVHCHRIVNDNIFTNLIL
FFILLSSISLAAEDPVRHLSFRNQILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRN
YFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIR
TIGNIVIVTTLLQFMFACIGVQLFKGKLYSCTDSSKQTEAECRGYYITYKDGEVSQPMIQ
PRSWENSKFDFDNVLTAMMALFTVSTFEGWPELLYRSIDSHMEDVGPIYNHRVEISIFFI
IYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQ
YQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCMFKEAMNILNMLFTGLFTVEMV
LKLIAFKPKHYFCDAWNTFDALIVVGSIVDIAITEVNPAENTQCSSSMNAEENSRISITF
FRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIAL
NDTTEINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPDKKCDPDSEPANSTEADHSC
GSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPE
AKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVR
TALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEY
FRKFKKRKEQGLVGKPSQRNALSLQFAVLQAGLRTLHDIGPEIRRAISGDLTAEEELDKA
MKEAVSAASEDDIFRRAGGLFGNHVSYYQSDGRSAFPQTFTTQRPLHINKSGNNQGDTES
PSHEKLVDSTFTPSSYSSSGSNANINNANNTALCRFPSPPSYPSTVSTVEGHGTPLSPTI
RVQEAPWKLPSKRTHYYETLGRSSSRDSQLAIVCQEEVSQDETYDENLNEDIEYCSEPSL
LSTEMLAYQDDENRQLTPPENNKGEDTRHSPKKGFLCSSALGRRASFHLECLKRQKNQGV
DVSQKTVLPLQMVHHQALAVAGLSPLLQRSHSPTTFSRLCATPPATPCSRGWPQQPIPTL
RLEGAESSEKLNSSFPSVHCSSRFPDSSDCGSPRRARPVSLTVPSPTAGSSRQFHGSASS
LVEAVLISEGLMQFAQDPKFIEVTTQELADACDMTIEEMENAADNILNGNSKQSPNGNLL
PFVNCRDAGQDSAGEEEEEVQNPDCRKSQEELKDSRIYISSL
NT seq 6609 nt   +upstreamnt  +downstreamnt
atgtttcaagcctttgttcggcaagcataccaaccgctatccagccaccagcaaggggaa
tctgaaacgaagtacagggggaagctggtgcatgaaactcagctcaactgcttctacatc
aaacctggaggttccaattatgggagtccccgtccagctcatgccaacatgaatgccaat
gcagctgcagggcttgccccagagcatatccctacaccaggggcagctctgtcctggcaa
gctgcaattgatgctgccaggcaagccaaattgatgggtagtgctggcaatgcaacaata
tccacagctagctccacgcagagaaaacggcagcagtacgggaaacagaaaaaacagggt
accacgacagctacgcgtcctccccgggcactgctgtgtttaacactgaaaaatcccatc
cggagggcatgcatcagcatcgtcgaatggaaaccatttgaaataattattttactgact
atttttgccaattgtgtggccttagctatctatatcccctttccagaagatgattccaat
gccaccaattccaatctggaacgagtggaatatctctttctcataatttttacagtggaa
gcatttttaaaagtaatagcatatggacttctctttcaccccaacgcttacctccgcaat
ggctggaatttactagattttataattgtggtagtagggctttttagtgcaattttagaa
caagcaaccaaagcagatggggggaattcaataggaggaaaaggtgccggatttgatgtt
aaagcactgcgggctttccgagtattacgtcccttacgactggtgtctggagttcctagt
ctccaggtggttttaaattcaattatcaaggccatggtccctttgttgcatattgccctg
ctggtgctgtttgtcatcattatctatgccatcattggactggagttattcatgggaaag
atgcataagacctgctaccacgtgcaagggggactgatagatacgcctgcagaagatgac
ccatctccctgtgccccccagtccgcacatgggcggcagtgccagaatggaaccgagtgc
aaggcaggctgggagggacccaagcacggcattacgaactttgacaattttgcttttgcc
atgctgacagtgtttcagtgcatcacgatggaggggtggacagatgtactctactggatg
caggacgctatgggctatgagttaccatgggtgtattttgtcagtctggtcatctttgga
tcctttttcgttctaaatctggtacttggtgtgttgagcggggaattttccaaggaaaga
gagaaggctaaggctcggggagatttccagaagttacgggaaaagcaacagctagaggag
gatttgaagggctatttagactggataactcaagcagaagatattgacccagaaaatgaa
gatgaaggcatggatgaggagaagcctcgaaacagaagcactccagctggcttgcctgat
aagaagaaagaaaagttttcttggtttagtcactccacagaaacccatgtgagcatgccc
accagtgagaccgagtccgtgaacacagacaacgtccctggaacagatattgaaggcgaa
aactgcggtgctaggctagcgcatcggatctccaaatctaaatttagtcgctattggcgc
cgatggaatcgattctgcagacgaaagtgccgtgctgctgtcaagtccaatgttttctac
tggttggtgatcttccttgtgtttctcaacacccttaccattgcctctgaacactacaac
cagccagactggctcactgaggttcaagacactgccaataaggtgctgctagctcttttc
acggcagagatgctgctgaagatgtacagcctcggtctccaggcctattttgtgtccctc
ttcaaccgctttgactgtttcattgtgtgtggaggaatcctggaaacaattctggttgag
acgaagatcatgtcaccattgggcatttctgtgttgagatgtgttcggctattaagaata
tttaaaatcacaagatattggaactccctgagtaacctagtggcttcactcctgaattca
gtccgttccattgcctccctcctgctgctcctcttcctcttcatcatcatcttctcactg
ctggggatgcagctttttgggggcaagtttaactttgatgaaatgcagaccaggaggagt
acatttgacaacttcccccagtccctcctcactgtgtttcagatcctgactggggaggac
tggaattcggtgatgtatgatgggatcatggcttatggcggcccctcttttccaggaatg
ttggtctgtatttacttcatcatcctcttcatctgtgggaactacatcctgctgaatgta
tttttggccattgctgtggacaaccttgctgatgcggagagtttaacatctgcacagaag
gaagaggaagaggaaaaagaaaggaaaaaactagctaggactgctagtcctgaaaagaaa
caggagatagagaaaacagctgtggaggaggagacaaaggaggagaaaattgagctgaaa
tcaatcactgctgatggagaatccccacctgctacgaagatcaacatggatgactatcag
ccaaacgaaaatgaagaaaagagcccatatcccacaacagaagcaccagcagaggaagat
gaggaagaacctgaaatgcctgtcggccctcggcctcgcccaatgtctgagctgcacctc
aaggaaaaggctgtgcccatgcctgatgccagcgcttttttcatcttcagtcctaacaac
aggttccgtgtccactgccatcgaatcgttaacgataacattttcaccaacctgatccta
tttttcatcttgctcagcagcatctccttggcagctgaggaccccgtccgacacctctcc
tttaggaaccaaatcctaggcaatgcagactatgtcttcactagtatctttacattagaa
attattcttaagatgaccgcatacggggctttcctccataagggctccttctgcagaaac
tatttcaacatcttagacctgctggtggtcagcgtttctctcatctcttttggaatccaa
tccagtgccatcaatgtggtgaagattttgcgtgttctgcgagtgcttcgacctctgagg
gccatcaacagagccaaaggactaaagcatgtggtccaatgtgtgtttgttgccatccga
accatcggaaacattgtgattgtcaccactttgctgcagttcatgtttgcctgcattgga
gttcagttgtttaagggcaaactctacagctgtactgatagctccaagcagactgaagca
gaatgcagagggtactacatcacatacaaggatggtgaggtcagtcagccgatgatccaa
ccccggagctgggagaacagcaagtttgacttcgacaatgtcttgactgccatgatggcc
ctcttcactgtctcaacctttgaaggatggccagagttgctgtataggtccattgattcc
cacatggaggatgtgggacccatctataatcacagggttgagatctccatcttctttatt
atctacatcatcatcattgctttcttcatgatgaacatcttcgttggtttcgtcatcgtc
acatttcaggaacaaggagaacaagaatacaagaactgtgagctggacaagaaccagcgc
cagtgtgtagagtatgccctgaaggcccggcccctgcggagatacatcccaaaaaaccag
taccagtacaaagtttggtatgtggtcaactccacctattttgaatacctgatgttcgtt
ttgatcctgctgaacaccatctgtctggccatgcaacactacggtcagagctgcatgttc
aaggaagccatgaacatcctcaacatgctcttcactggcctcttcactgtcgagatggtc
ctgaagttaattgccttcaaacccaagcactatttctgtgatgcatggaatacatttgac
gccttgattgttgtgggtagcattgttgatatagcaatcaccgaggtgaacccagctgaa
aatacccaatgctcttcctctatgaacgcagaggaaaactctcgcatctcaatcaccttc
ttccgactcttccgcgtgatgcgtcttgtgaagctcctgagccgaggggagggcatccgg
acactgctttggaccttcatcaagtccttccaggctctcccctatgtggctcttctaata
gtgatgctgttcttcatctacgccgtgatcgggatgcaggtgtttggtaaaattgcactg
aacgataccacagaaatcaaccgcaacaacaacttccagaccttcccccaagcggtgctg
ctgcttttcaggtgtgccaccggtgaggcctggcaggaaatcatgctggcgtgtctccca
gacaagaagtgcgaccccgactcagagccggccaactccaccgaagccgaccactcctgt
ggcagcagctttgctgtcttctacttcataagcttctacatgctctgtgccttcctgatc
atcaatctttttgtagctgttataatggataacttcgattacctgacacgggactggtcc
attttaggaccacaccacctagatgagtttaaaaggatctgggcagagtatgaccctgaa
gccaagggacggatcaagcacttggatgtggtgacactgctccggcggattcagcctcca
ctgggcttcgggaagctttgccctcaccgagtggcttgcaaacgccttgtctccatgaat
atgccactaaacagcgatggaactgtcatgttcaatgccaccctctttgcgctggtcaga
actgcactgaggatcaagacagaaggtaacctggagcaagccaatgaagagcttagagca
ataattaagaaaatctggaagcgcaccagtatgaagctgctggaccaggtggtgcctcct
gcaggtgatgacgaggtgactgttgggaagttctacgccactttcctgattcaagagtat
ttccggaagttcaagaaacgcaaagagcagggcctggtgggcaagccttcccagcgcaac
gcactctccttgcagtttgctgttttgcaggctggtttgcgcacacttcatgacattggt
ccagagatccgacgagcgatctctggagacctgacagctgaagaagagctagataaggct
atgaaagaagctgtttctgctgcctctgaagatgatatcttccggagagccggaggcttg
tttggaaaccatgtcagctattaccaaagtgatggcaggagtgcattcccccagacattc
accacgcagagacctttgcacatcaataagtctggcaacaaccagggagataccgagtct
ccatctcatgagaagttggtggattctaccttcactcccagcagctactcatcttcaggc
tccaatgcaaacatcaacaatgccaacaacacagccctgtgccgcttcccaagcccaccc
agctaccccagcactgtcagcacagtggaaggccatgggactccattgtcacctaccata
cgtgtgcaagaagctccttggaaactaccttccaaaaggacgcactactacgaaacactg
ggacgctccagttccagagacagccagctggcaattgtttgccaagaggaagtgtctcag
gatgagacttatgatgaaaatttgaatgaagacattgagtactgtagtgaaccaagtctg
ctctctactgaaatgctcgcataccaagatgacgaaaacagacaacttactccaccagaa
aacaacaaaggagaggacacccggcactctccgaagaaagggtttctgtgctcctcagct
ctaggtcgacgagcatctttccacttagagtgtctgaaaagacagaaaaaccagggcgta
gatgtctcgcagaagacagttctgcctttacaaatggtacatcatcaggcactggcggtg
gccggcctgagccccctcctccagcgaagccattcccccaccacgttctcccggctgtgc
gccacaccgcctgctacaccctgcagccgaggctggccacagcagcccatcccgacgctg
cgcctcgagggggctgagtccagtgagaagctcaacagcagcttcccctccgtgcactgc
agctcccggttccccgacagctctgactgtggcagcccaaggagagccaggccggtgtcc
ctcaccgtccccagcccgacggcagggagcagcaggcagttccatggcagcgccagcagc
ctggttgaagcggtgttgatttcggaaggactgatgcagtttgctcaagatccaaagttc
attgaggtcacgacccaggaactcgctgacgcctgtgacatgacgatagaagagatggaa
aacgcagcagacaacattctcaatggtaacagcaagcagagccccaatggcaacctgttg
ccttttgttaactgcagggacgcagggcaggacagtgcaggcgaggaagaggaagaggtg
cagaacccggattgtagaaaaagtcaggaggagctgaaggacagcaggatttatatcagc
agcctgtag

DBGET integrated database retrieval system