KEGG   Gallus gallus (chicken): 396027
Entry
396027            CDS       T01006                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04137  Mitophagy - animal
gga04210  Apoptosis
gga04218  Cellular senescence
gga04620  Toll-like receptor signaling pathway
gga04621  NOD-like receptor signaling pathway
gga04622  RIG-I-like receptor signaling pathway
gga04623  Cytosolic DNA-sensing pathway
gga04625  C-type lectin receptor signaling pathway
gga04920  Adipocytokine signaling pathway
gga05132  Salmonella infection
gga05164  Influenza A
gga05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    396027 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    396027 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    396027 (RELA)
   04218 Cellular senescence
    396027 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    396027 (RELA)
   04621 NOD-like receptor signaling pathway
    396027 (RELA)
   04622 RIG-I-like receptor signaling pathway
    396027 (RELA)
   04623 Cytosolic DNA-sensing pathway
    396027 (RELA)
   04625 C-type lectin receptor signaling pathway
    396027 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    396027 (RELA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    396027 (RELA)
  09172 Infectious disease: viral
   05164 Influenza A
    396027 (RELA)
   05168 Herpes simplex virus 1 infection
    396027 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    396027 (RELA)
Transcription factors [BR:gga03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    396027 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 396027
NCBI-ProteinID: NP_990460
CGNC: 49615
Ensembl: ENSGALG00000039409
UniProt: P98152
LinkDB
Position
33
AA seq 558 aa
MEPADLLPLYLQPEWGEQEPGGATPFVEILEQPKQRGMRFRYKCEGRSAGSIPGEHSTDS
ARTHPTIRVNHYRGPGRVRVSLVTKDPPHGPHPHELVGRHCQHGYYEAELSPERCVHSFQ
NLGIQCVKKRELEAAVAERIRTNNNPFNVPMEERGAEYDLSAVRLCFQVWVNGPGGLCPL
PPVLSQPIYDNRAPSTAELRILPGDRNSGSCQGGDEIFLLCDKVQKEDIEVRFWAEGWEA
KGSFAAADVHRQVAIVFRTPPFRERSLRHPVTVRMELQRPSDRQRSPPLDFRYLPHQGDL
QCIEEKRKRTRDTFRAFVQRAPLPGLEPNPEPRPPRRIAVPSRPPPAPQQPPSMVGAPPA
PLFPLGVPPASSPTPEPLAEALLQLQFDDGVGGSGPPPSTTTTTTTTQCALGGGIPDPGG
SPLDLGALLGDPPFDTIDAAELQRLLGPPETPPGGIGAGGGFGELLSLPTNFGDPPSSTA
ATFGPSPPMLLSYPEAITRLVQCQTPGGSGGGGPPVGPPQDLGGPLHPPGAPPQPTEDSL
PSLGDLDFSAFLSQFPSS
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggagcccgcggatctgctgcccctgtacctgcagccggaatggggcgagcaggagccg
gggggggccaccccttttgtggagatcctggagcagccgaagcagcgcgggatgcggttc
cgctataagtgtgaagggcgctcagctgggagcatccctggggagcacagcacagacagc
gcccgcacgcaccccaccatccgcgtaaaccattaccggggtccgggccgcgttcgggtc
tctttggtgacgaaggaccccccccacggcccccacccccacgagttggtgggccgccat
tgccagcatggctactatgaggccgagctcagccccgagcgctgcgtgcacagtttccag
aatttgggcattcagtgtgtgaagaaacgggaactggaagcggcggtggctgaacggatc
cgcaccaataacaaccccttcaatgtgccaatggaggagcgcggtgccgaatacgacctg
agcgcggtgcggctctgcttccaggtgtgggtgaacggccccggggggctctgcccgctg
ccccccgtcctctcccagcccatctatgacaaccgtgcccccagcacagccgagctgcgc
atcttgccgggtgaccgcaactctgggagctgccaggggggggatgagatcttcctgctc
tgtgacaaggtccagaaagaggacatcgaggttcgtttctgggctgagggctgggaggcg
aagggcagcttcgcggcggccgacgtacaccgccaggttgccatcgtgttccgcacgccg
cccttccgggagcgctccctccgccacccggtcaccgtccgcatggagctgcagcgcccc
tccgaccgccagcgcagcccccccctcgatttccgctacctgccccaccagggggacctg
cagtgcattgaggagaagcgcaaacgcacgcgggacaccttccgtgccttcgtccagcgg
gcaccactgccaggtctggaaccaaaccctgagccgcggcccccccggcgcattgcagtg
ccttcccggccccccccagccccccagcagccccccagcatggtgggagccccccctgct
ccccttttccctctgggggtgccccccgcctcctccccaaccccggagcctttggccgaa
gctctgctccaactgcagttcgacgatggggtgggggggtccggaccccccccctccacc
accaccaccaccaccacaacacaatgcgctctggggggcggcatccccgatccggggggg
tcccctttagatttgggggctcttctgggtgaccccccctttgataccatcgacgccgct
gagttgcaacgattgctgggcccccccgagacccccccaggtgggattggggctgggggg
ggttttggggagctcctctccctcccgacgaattttggggaccccccctcatccaccgcc
gccacatttgggccctccccccccatgctgctctcctatcccgaagccatcacacgtttg
gtgcagtgtcagaccccgggggggtcaggaggggggggacctcctgttggacccccccag
gatttaggggggcctctacatcctcccggagcccccccccagcccacggaggactccctg
ccctccctgggggacctggacttcagtgccttcctcagccagttcccttcatcctga

DBGET integrated database retrieval system