KEGG   Gallus gallus (chicken): 396028
Entry
396028            CDS       T01006                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand isoform 1 precursor
  KO
K05461  KIT ligand
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    396028 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    396028 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gga04052]
    396028 (KITLG)
Cytokines and growth factors [BR:gga04052]
 Growth factors
  Growth factors (RTK binding)
   396028 (KITLG)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 396028
NCBI-ProteinID: NP_990461
CGNC: 8510
Ensembl: ENSGALG00000011206
UniProt: Q09108 Q009U6
LinkDB
Position
1
AA seq 287 aa
MKKAQTWIITCFCLQLLLLNPLVKAQSSCGNPVTDDVNDIAKLVGNLPNDYLITLKYVPK
MDSLPNHCWLHLMVPEFSRSLHNLLQKFSDISDMSDVLSNYSIINNLTRIINDLMACLAF
DKNKDFIKENGHLYEEDRFIPENFFRLFNSTIEVYKEFADSLDKNDCIMPSTVETPENDS
RVAVTKTISFPPVAASSLRNDSIGSNTSSNSNKEALGFISSSSLQGISIALTSLLSLLIG
FILGAIYWKKTHPKSRPESNETIQCHGCQEENEISMLQQKEKEHLQV
NT seq 864 nt   +upstreamnt  +downstreamnt
atgaagaaggcacaaacttggattatcacttgcttttgtcttcaactactcctacttaat
cctcttgtcaaagcccagagttcctgcgggaatccagtgacagatgatgtaaatgatatt
gcaaaattggttggaaatctcccaaatgattatctgataacccttaaatatgtcccgaag
atggatagcctgcctaatcactgttggttgcatttgatggtgcctgaattttcaaggagt
ctacataatcttctccagaaattttcagatatttccgatatgtctgatgttttaagcaac
tattcaatcattaataacctcacaaggataatcaatgatcttatggcatgtttagctttt
gataaaaataaggattttataaaagaaaatggtcacctttatgaagaagatcgtttcatt
cctgagaatttttttaggctctttaatagtaccattgaggtctacaaggagtttgcagat
tcattggataagaacgactgcattatgccttcaactgtagaaacaccagagaatgattcc
agagtcgctgtcacaaaaacaatttcgtttcctcctgttgctgccagctcccttaggaat
gacagcattggcagtaatactagcagtaacagtaacaaagaggcacttggcttcattagc
agctccagcctgcaagggatcagcatagcattgacatcattgctgtctcttctcattggc
tttattctgggagccatatactggaagaaaacacatcctaagtccagaccagaaagtaat
gaaactatacagtgtcatggttgtcaagaggaaaatgagataagtatgttgcagcaaaaa
gaaaaagaacatctacaagtgtag

DBGET integrated database retrieval system