KEGG   Gallus gallus (chicken): 396094
Entry
396094            CDS       T01006                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1 precursor
  KO
K18496  fibroblast growth factor 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    396094 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    396094 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gga04052]
    396094 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    396094 (FGF1)
Cytokines and growth factors [BR:gga04052]
 Growth factors
  Growth factors (RTK binding)
   396094 (FGF1)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   396094 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 396094
NCBI-ProteinID: NP_990511
CGNC: 5548
Ensembl: ENSGALG00000031255
UniProt: P19596 A0A2L2DDN9
LinkDB
Position
13
AA seq 155 aa
MAEGEITTFTALTERFGLPLGNYKKPKLLYCSNGGHFLRILPDGKVDGTRDRSDQHIQLQ
LSAEDVGEVYIKSTASGQYLAMDTNGLLYGSQLPGEECLFLERLEENHYNTYISKKHADK
NWFVGLKKNGNSKLGPRTHYGQKAILFLPLPVSAD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggccgagggggagataaccaccttcaccgccctgaccgagcgcttcggcctgccgctg
ggcaactacaagaagcccaaactcctgtactgcagcaacgggggccacttcctacggatc
ctgccggacggcaaggtggacgggacgcgggaccggagtgaccagcacattcagctgcag
ctcagcgcggaagatgtgggcgaggtctatataaagagcacagcgtcggggcagtacctg
gcaatggacaccaacgggctcctgtatggctcgcagctaccaggcgaggagtgcttgttc
cttgagaggctcgaggagaaccattacaacacatacatctccaaaaagcacgcagacaag
aactggttcgtcgggctgaagaaaaacgggaacagcaagctggggccgcggactcactat
gggcaaaaggcgatcctcttcctcccattgccggtgtcggctgactga

DBGET integrated database retrieval system