KEGG   Gallus gallus (chicken): 396341
Entry
396341            CDS       T01006                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04068  FoxO signaling pathway
gga04110  Cell cycle
gga04115  p53 signaling pathway
gga04218  Cellular senescence
gga04310  Wnt signaling pathway
gga04340  Hedgehog signaling pathway
gga04371  Apelin signaling pathway
gga04510  Focal adhesion
gga04530  Tight junction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    396341 (CCND1)
   04340 Hedgehog signaling pathway
    396341 (CCND1)
   04371 Apelin signaling pathway
    396341 (CCND1)
   04068 FoxO signaling pathway
    396341 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    396341 (CCND1)
   04115 p53 signaling pathway
    396341 (CCND1)
   04218 Cellular senescence
    396341 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    396341 (CCND1)
   04530 Tight junction
    396341 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 396341
NCBI-ProteinID: NP_990712
CGNC: 5701
Ensembl: ENSGALG00000007555
UniProt: P55169
LinkDB
Position
5
AA seq 292 aa
MEHQLQCCEVETIRRAYLDANLLNDRVLQTMLKAEETCSPSVSYFKCVQKEILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSFEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLTKMPLAEDTKQIIRK
HAQTFVALCATDVKFISNPPSMIAAGSVVAAVQGLHLGNTNTFLSYQCLTHFLSQVIKCD
PDCLRACQEQIESLLESSLRQAQQHNVSSETKTVEDEADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacatcagctgcagtgctgcgaggtggagaccatccgacgagcctacctggacgcc
aacctgctcaatgacagggtgctgcagaccatgctgaaggcggaggagacctgctcgccc
tcggtgtcctacttcaagtgcgtgcagaaggaaatcttgccatatatgaggaaaatagtc
gccacttggatgctggaggtctgcgaggagcagaagtgcgaagaggaagttttccccttg
gcgatgaattatttggacaggtttttgtcgttcgaacccctcaagaaaagccggttgcaa
ttgctcggagctacctgcatgtttgtggcttccaaaatgaaggaaacgattcctctgacc
gcagaaaaactgtgcatttacaccgacaactccatcagacccgacgagttactgcaaatg
gagctgctgctggtgaataagctgaaatggaatctggctgcaatgaccccccacgatttc
attgaacatttcctcactaaaatgcctctggcagaggacaccaaacagatcatccgtaaa
catgctcagacttttgtggctctgtgcgctacagatgttaaatttatttcaaacccacct
tccatgatcgcagctggcagtgtggtagcagctgtgcaaggcctgcatctggggaacact
aacactttcctctcctatcaatgcctcacacatttcctatcacaagttatcaaatgtgat
ccggattgtttacgagcctgccaagaacagattgaatccctccttgaatccagtctacgc
caggcacagcagcacaacgtatcttcagaaacaaagactgtagaggacgaagcagacctt
tcctgcacacccactgatgtgcgagatgtgaacatttaa

DBGET integrated database retrieval system