KEGG   Gallus gallus (chicken): 396344Help
Entry
396344            CDS       T01006                                 

Gene name
PRSS2
Definition
(RefSeq) trypsin II-P29 precursor
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04080  Neuroactive ligand-receptor interaction
gga05164  Influenza A
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    396344 (PRSS2)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    396344 (PRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:gga01002]
    396344 (PRSS2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    396344 (PRSS2)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     396344 (PRSS2)
Peptidases [BR:gga01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   396344 (PRSS2)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   396344 (PRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 396344
NCBI-ProteinID: NP_990715
CGNC: 49760
Ensembl: ENSGALG00000032796
UniProt: Q90629
LinkDB All DBs
Position
1
AA seq 248 aa AA seqDB search
MKFLFLILSCLGAAVAFPGGADDDKIVGGYTCPEHSVPYQVSLNSGYHFCGGSLINSQWV
LSAAHCYKSRIQVRLGEYNIDVQEDSEVVRSSSVIIRHPKYSSITLNNDIMLIKLASAVE
YSADIQPIALPSSCAKAGTECLISGWGNTLSNGYNYPELLQCLNAPILSDQECQEAYPGD
ITSNMICVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGIGCALKGYPGVYTKVCNYVDW
IQETIAAY
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttctcttcctgattctctcctgcctgggagcagctgttgctttccctggaggt
gccgatgatgacaagattgtgggaggctacacctgcccagagcattcggttccctaccag
gtgtccctgaactctgggtatcacttctgtggagggtccctcatcaacagccagtgggtc
ttgtcagctgctcactgctataaatcccgtatacaagtgaggctgggagagtacaacatc
gatgtgcaggaagacagtgaagtagtcaggagttcatcagtaatcattcgccatcctaaa
tacagttcaataaccctcaataatgacattatgttgatcaagttggcatctgcggtggaa
tacagtgccgacattcaacccatagctctgcccagctcctgtgccaaggcggggaccgag
tgcctgatctcagggtggggaaacacgctgagcaatggctacaattaccctgaacttctc
cagtgcctgaacgctccgattctgagtgaccaagagtgccaggaggcctacccgggtgat
atcaccagcaacatgatctgtgtcgggttcctggagggtgggaaagactcgtgccagggt
gactcgggtggaccagttgtgtgcaatggagaactgcaaggtattgtgtcctggggaatt
ggatgtgctctgaaaggttatcccggagtttacaccaaggtctgcaattacgttgactgg
atccaggaaaccattgcagcctactga

DBGET integrated database retrieval system