KEGG   Gallus gallus (chicken): 396399
Entry
396399            CDS       T01006                                 

Gene name
TGFBR2
Definition
(RefSeq) TGF-beta receptor type-2 precursor
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04060  Cytokine-cytokine receptor interaction
gga04068  FoxO signaling pathway
gga04144  Endocytosis
gga04218  Cellular senescence
gga04350  TGF-beta signaling pathway
gga04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    396399 (TGFBR2)
   04350 TGF-beta signaling pathway
    396399 (TGFBR2)
   04068 FoxO signaling pathway
    396399 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    396399 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    396399 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    396399 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    396399 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    396399 (TGFBR2)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     396399 (TGFBR2)
Protein kinases [BR:gga01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   396399 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase APH FixQ
Other DBs
NCBI-GeneID: 396399
NCBI-ProteinID: NP_990759
CGNC: 8694
Ensembl: ENSGALG00000011442
UniProt: Q90999
LinkDB
Structure
PDB: 
1KS6

Position
2
AA seq 557 aa
MPPRLRPLLLRVSLWVLVGSSSPALLHDRSKENGLQLPRLCKFCDVKATTCSNQDQCKSN
CNITSICEKNNEVCAAVWRRNDENVTLETICHDPQKRLYGHMLDDSSSEQCVMKEKKDDG
GLMFMCSCTGEECNDVLIFSAIDPHKPEEKDEISKVTIISLVPLLVISVAVIVIFYAYRT
HKKRKLNKAWEKNVKPKKHKDCSDVCAIMLDDDHSDISSTCANNINHNTELLPIELDIVV
GKGRFAEVYKAKLKQNTSEQYETVAVKIFPYEEYASWKTEKDIFSDVNLKHENILQFLTA
EERKTDLGKQYWLITAFHARGNLQEYLTRHIISWEDLWKLGGSLARGIAHLHSDHTPCGR
PKTPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPSLSVDDLANSGQVGTARYMAPEVL
ESRMNLENMESFKQTDVYSMALVLWEMTSRCNGVGEVKEYEPPFGSKVREHPCVESMKDN
VLRDRGRPEIPSSWLNHQGIQMVCETLIECWDHDPEARLTAQCVAERFSEFKHHDKLSGR
SCSEEKIPEDGSVTTAK
NT seq 1674 nt   +upstreamnt  +downstreamnt
atgcctccgcgcctgcggccgctgctcctgcgcgtgtccctgtgggtactcgtgggctcc
tcgagccccgcgctcctacacgatagaagcaaggaaaatggactgcaattgcccaggcta
tgcaaattctgtgacgttaaggcaacaacgtgctcaaaccaagatcagtgcaagagcaac
tgcaacatcacttctatctgtgagaagaataacgaagtctgtgcagctgtatggagacgg
aatgatgaaaatgtgacgttagaaacaatctgccatgatccccagaaaaggctgtatggt
cacatgttggatgactccagctcagagcagtgtgtgatgaaggaaaagaaggatgatggg
ggactgatgttcatgtgttcctgtacaggtgaagagtgcaacgatgttcttattttttct
gcaattgatccccataagccagaggagaaagatgaaatttccaaagtcacaatcataagt
cttgtccctttattggtgatttctgttgctgtgattgttatcttttatgcctaccgcact
cacaagaagaggaagctcaacaaggcctgggagaagaatgtcaagcccaagaaacataaa
gactgcagcgatgtttgtgctattatgttggatgatgaccactcagacatcagctctacc
tgtgccaacaacatcaaccacaacacagaattgctgcccattgaactggacattgttgtt
ggcaaaggaaggtttgctgaagtgtataaagccaaattgaagcaaaacacatctgagcag
tatgaaactgtggcagtaaagatcttcccctatgaagaatatgcctcctggaagaccgag
aaagacattttttcagatgtaaatcttaagcatgagaacatcctccaattcttgaccgca
gaggagcgtaagacagatcttggtaaacagtattggttgatcactgccttccatgctaga
ggaaacttgcaggaatacctcacacggcatattatcagctgggaagacctctggaaactg
ggaggatccttggcccgagggattgcccatctgcacagtgatcatacaccttgtggtcgc
cctaaaacccctattgtgcacagagacctaaagagttccaacatcctggtgaaaaatgat
ttaacttgctgtctctgtgactttgggttatccctgaggctggacccttctctctctgtg
gatgacttggccaacagtggtcaggttggcacagcaaggtacatggcccctgaggttctg
gagtccaggatgaaccttgagaacatggagtcctttaaacaaacagatgtgtactccatg
gctttggtcctctgggaaatgacatctcgctgtaacggtgttggagaagtgaaagagtat
gagcccccattcggctctaaagtgcgagagcatccctgcgtggaaagcatgaaggacaat
gtcctaagagacagagggcgacccgagatccccagctcctggcttaaccatcagggcatc
cagatggtgtgcgagacccttatcgagtgctgggaccacgaccccgaggctcggctcacg
gcgcaatgcgtggcggagcgcttcagcgagttcaagcaccacgacaagctctcagggaga
agctgttcggaggagaagatccccgaggacggctccgtgaccaccgccaagtag

DBGET integrated database retrieval system