KEGG   Gallus gallus (chicken): 396432Help
Entry
396432            CDS       T01006                                 

Gene name
TGM2
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 2
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     396432 (TGM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 396432
NCBI-ProteinID: NP_990779
CGNC: 49801
Ensembl: ENSGALG00000006775
UniProt: Q01841
LinkDB All DBs
Position
32
AA seq 698 aa AA seqDB search
MGGPGPDGTMAEELVLETCDLQCERNGREHRTEEMGSQQLVVRRGQPFTITLNFAGRGYE
EGVDKLAFDVETGPCPVETSGTRSHFTLTDCPEEGTWSAVLQQQDGATLCVSLCSPSIAR
VGRYRLTLEASTGYQGSSFHLGDFVLLFNAWHPEDAVYLKEEDERREYVLSQQGLIYMGS
RDYITSTPWNFGQFEDEILAICLEMLDINPKFLRDQNLDCSRRNDPVYIGRVVSAMVNCN
DEDHGVLLGRWDNHYEDGMSPMAWIGSVDILKRWRRLGCQPVKYGQCWVFAAVACTVMRC
LGVPSRVVTNYNSAHDTNGNLVIDRYLSETGMEERRSTDMIWNFHCWVECWMTRPDLAPG
YDGWQALDPTPQEKSEGVYCCGPAPVKAIKEGDLQVQYDIPFVFAEVNADVVYWIVQSDG
EKKKSTHSSVVGKNISTKSVGRDSREDITHTYKYPEGSEKEREVFSKAEHEKSSLGEQEE
GLHMRIKLSEGANNGSDFDVFAFISNDTDKERECRLRLCARTASYNGEVGPQCGFKDLLN
LSLQPHMEQSVPLRILYEQYGPNLTQDNMIKVVALLTEYETGDSVVAIRDVYIQNPEIKI
RILGEPMQERKLVAEIRLVNPLAEPLNNCIFVVEGAGLTEGQRIEELEDPVEPQAEAKFR
MEFVPRQAGLHKLMVDFESDKLTGVKGYRNVIIAPLPK
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgggtggaccgggaccggacgggaccatggccgaagagctggtgctggagacgtgcgac
ctgcagtgcgagcgcaatggccgcgagcaccggacggaggagatgggcagccagcagctg
gtggtgcggcgcgggcagcccttcaccatcaccctgaacttcgccggacggggctacgag
gagggggtggacaaactcgccttcgacgtggagacggggccctgtcccgttgagacgtca
ggcaccaggtcgcacttcaccttgaccgactgccccgaggaggggacctggagtgcagtg
ttgcagcagcaggatggggccacgctctgtgtatcgctctgctcccccagcattgcccgc
gtgggccgctaccgcctgacgctggaggcctccacggggtaccagggctccagcttccac
ctcggggacttcgttctgctcttcaatgcctggcacccagaggatgcagtgtacctgaag
gaagaggacgagcgccgtgagtacgtgctgtcccagcaggggctcatctacatgggctcc
agggactacataacctccacaccctggaactttgggcagtttgaagatgagatcttggcc
atctgcctcgagatgctggacatcaaccccaaattcctgcgggaccagaacctggactgc
tcccgtcgcaatgaccctgtttatattggcagggtggtgagcgccatggtcaactgcaat
gacgaggaccacggggtgctgctggggcgctgggacaatcactatgaggatgggatgagc
ccaatggcatggatcggcagcgtggacatcctcaagaggtggaggaggttgggctgccag
cctgtcaagtacggccagtgctgggtcttcgctgccgtggcgtgcactgtcatgcgctgc
ctgggcgtccccagccgtgtggtcaccaactacaactctgcccacgacaccaacggcaac
ctggtgatcgaccgctacctgagcgagacgggcatggaggagcggcgctccacggacatg
atctggaacttccactgctgggtggagtgctggatgacccggcctgacctggcacctgga
tacgatgggtggcaagcgctggaccccacgccccaggagaagagcgaaggggtttactgc
tgcgggccggcccctgtcaaggccatcaaggagggcgacctgcaggtgcagtacgacatc
cccttcgtctttgcggaggtcaatgctgacgtggtgtactggatcgttcagagtgacggt
gagaagaagaagagcacccactcctcagtggtggggaagaacatcagcaccaagagcgtc
ggcagggacagccgcgaggacatcacccacacctacaagtatccggaggggtctgagaag
gagcgagaggtgttcagcaaggcggagcacgagaagagctcgctgggtgagcaggaagag
gggctccacatgcggatcaagctgtcggagggtgccaacaacggctccgacttcgacgtc
ttcgctttcatcagcaacgacacggacaaggagcgtgagtgcaggctgaggctgtgcgcc
cgcaccgccagctacaacggcgaggtgggcccgcagtgcggcttcaaggacctgctgaac
ctcagcctccagccccacatggaacagagcgtgcccttgcgcatcctctatgagcagtac
gggcccaacctgacccaggacaacatgatcaaggtggtggctctgctgactgagtatgag
actggtgacagcgtggtggccatcagggatgtctacatccagaacccagagatcaagatc
aggattttaggggagccaatgcaggagcggaagctggtggcagagatcagactggtgaac
ccactggcagagccactgaacaactgcatattcgtggtggaaggcgccggcctcactgag
gggcagaggatcgaggagcttgaggatcctgtggagccgcaagcagaggccaagttccgg
atggagttcgtgccgcgccaggcagggctgcacaagctgatggtggactttgagagcgac
aagctgacgggagtgaagggctaccgcaacgtcatcatcgcacccctgcccaagtga

DBGET integrated database retrieval system