KEGG   Gallus gallus (chicken): 396451Help
Entry
396451            CDS       T01006                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2 isoform 1 precursor
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00590  Arachidonic acid metabolism
gga01100  Metabolic pathways
gga04370  VEGF signaling pathway
gga04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    396451 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    396451 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    396451 (PTGS2)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     396451 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 396451
NCBI-ProteinID: NP_001161191
CGNC: 3769
Ensembl: ENSGALG00000033635
UniProt: P27607
LinkDB All DBs
Position
8
AA seq 603 aa AA seqDB search
MLLPCALLAALLAAGHAANPCCSLPCQNRGVCMTTGFDRYECDCTRTGYYGENCTTPEFF
TWLKLILKPTPNTVHYILTHFKGVWNIINNISFLRDTIMRYVLTSRSHLIDSPPTYNSDY
SYKSWEAYSNLSYYTRSLPPVGHDCPTPMGVKGKKELPDSKLIVEKFLLRRKFIPDPQGT
NVMFTFFAQHFTHQFFKTDHKKGPGFTKAYGHGVDLNHIYGETLERQLKLRLRKDGKLKY
QMIDGEMYPPTVKDTQAEMIYPPHVPEHLQFSVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWDDEQLFQTTRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQRFQYQ
NRIAAEFNTLYHWHPLLPDTFQIHNQEYTFQQFLYNNSIMLEHGLSHMVKSFSKQSAGRV
AGGKNVPAAVQKVAKASIDQSRQMRYQSLNEYRKRFMLKPFKSFEELTGEKEMAAELEEL
YGDIDAMELYPGLLVEKPRPGAIFGETMVEIGAPFSLKGLMGNTICSPEYWKPSTFGGKV
GFEIINTASLQKLICNNVKGCPFTAFHVLNPEPTEATINVSTSNTAMEDINPTLLLKEQS
AEL
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgccttgtgcactgctggccgctctccttgctgccggccacgcagccaaccct
tgctgctccctcccatgtcagaacagaggtgtatgcatgacaacaggatttgatcggtat
gaatgtgactgcacgaggacgggctattatggggaaaactgtacaacaccggaattcttc
acgtggctgaaactaatattgaaacctacaccaaatactgtccactacattctcacccac
ttcaaaggagtctggaacatcatcaacaacatttccttcttacgagatactattatgaga
tacgtgttgacgtcgagatcacacttgattgacagcccaccaacatacaatagtgactac
agttacaaatcctgggaagcttattccaatctttcctattacacaagaagccttccacca
gtaggacatgactgtccaacaccaatgggtgttaaaggtaagaaagagctcccagattca
aagctgattgtggagaaattcttgctgcggagaaaatttattcctgacccacaaggcaca
aatgtgatgttcacattctttgcccagcacttcactcatcaattctttaagacagaccat
aagaaagggcctggcttcactaaagcttacggccatggggttgacttgaaccacatttat
ggagagactctggagaggcaacttaaattgagacttcgcaaggatggaaaactaaagtac
cagatgattgatggagaaatgtatccaccaacagtgaaggacactcaagcagagatgatc
taccctcctcatgttcctgagcatctgcagttttctgttgggcaggaggtgtttggcttg
gtcccaggcctaatgatgtatgcaacgatatggctgagagaacacaatagagtctgtgac
gtcttgaaacaggagcatccagagtgggatgatgagcagctatttcagactacaagactc
atattgataggagaaacgatcaagatagttattgaagattatgtgcagcacttaagtggc
taccatttcaaattgaagtttgaccctgagcttctgttcaaccagcgttttcaataccag
aaccgaatcgcagctgaattcaatactctgtaccactggcacccccttctgcctgacact
tttcagatacataaccaggagtacacattccagcagttcctctacaacaactccataatg
ctggaacatggcctttcccatatggtgaaatctttttccaagcaaagtgctggtagggtt
gctggtgggaaaaatgttccagctgcagtacagaaagtagcaaaggcttcaattgaccaa
agcagacaaatgagataccagtctttgaatgagtacaggaaacgcttcatgttgaaacca
ttcaaatcatttgaagaacttacaggagaaaaagaaatggctgctgaactagaagagctt
tatggagacatagatgctatggaactgtatccaggccttcttgtagaaaagccaagacca
ggtgccatctttggtgaaacaatggtagaaattggcgcaccgttctccctgaaaggactg
atgggaaatacaatatgctcccctgagtactggaagccaagcacttttggtggaaaagtg
gggtttgaaataatcaatactgcctccttacagaagctcatctgcaacaatgtgaaaggc
tgtcctttcactgctttccatgtcttaaatcctgaacccacagaggcaactattaatgtt
agtacctcaaacacagcaatggaagatatcaaccccacactactactgaaagagcaatct
gctgagttgtaa

DBGET integrated database retrieval system