KEGG   Gallus gallus (chicken): 414140Help
Entry
414140            CDS       T01006                                 

Gene name
AMY2A
Definition
(RefSeq) pancreatic alpha-amylase precursor
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00500  Starch and sucrose metabolism
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    414140 (AMY2A)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     414140 (AMY2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 414140
NCBI-ProteinID: NP_001001473
CGNC: 49908
Ensembl: ENSGALG00000038740
UniProt: A0A1D5PUZ5
LinkDB All DBs
Position
8
AA seq 512 aa AA seqDB search
MQVLLLLAAVGLCWAQYNPNTQAGRTSIVHLFEWRWADIALECERYLAPNGFGGVQVSPP
NENIVITNPNRPWWERYQPISYKICSRSGNENEFRDMVTRCNNVGVRIYVDAVVNHMCGS
MGGTGTHSTCGSYFNTGTRDFPAVPYSAWDFNDGKCHTASGDIENYGDMYQVRDCKLSSL
LDLALEKDYVRSTIAAYMNHLIDMGVAGFRIDAAKHMWPGDIRAFLDKLHDLNTQWFSAG
TKPFIYQEVIDLGGEPITGSQYFGNGRVTEFKYGAKLGTVIRKWNGEKMAYLKNWGEGWG
FVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWP
RYFENGVDVNDWVGPPSNSDGSTKSVTINADTTCGNDWVCEHRWRQIRNMVIFRNVVDGQ
PFSNWWDNGSNQVAFGRGDRGFIVFNNDDWYMNVDLQTGLPAGTYCDVISGQKEGSACTG
KQVYVSSDGKANFQISNSDEDPFVAIHVDAKL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtccttctcctcctcgcagctgtcgggctttgctgggcacagtacaatcccaac
actcaggctgggaggacatctatcgtgcatctctttgaatggcgctgggccgacattgca
ctggagtgcgaacgctatttagctcctaatgggtttggaggagttcaggtttctcctcca
aatgaaaacattgtcattactaatccgaacaggccctggtgggaaagataccagcccatc
agctacaagatctgcagtcgatcgggcaatgaaaatgaattcagagacatggtgaccaga
tgcaacaatgttggagttcgtatttatgtggatgctgttgtcaatcacatgtgtggatct
atgggtggcacgggcacccactcaacatgtgggagctatttcaacaccgggactagagat
tttcccgctgtgccgtactctgcctgggatttcaatgacggcaaatgtcacactgcaagt
ggagacatcgaaaattatggggacatgtatcaggtccgggattgcaagttgtccagcctt
cttgatctggctctggagaaggactatgtacgctcaacaattgcagcgtacatgaatcac
ctcattgatatgggtgtagcagggttccggatcgatgctgccaagcatatgtggccaggg
gacataagagcgtttctggacaaactgcacgatctaaatactcagtggttttcagcagga
acgaaaccctttatttaccaagaggtaattgacttgggaggagagccaatcacaggcagt
cagtactttgggaatggccgcgtgacagaattcaagtatggtgccaaactggggacggtg
atccggaagtggaatggagagaagatggcctacttaaagaactggggagaaggctggggc
tttgtgccttctgacagagccctggtgtttgtggataaccacgacaaccagcgggggcac
ggggcaggcggagcttccattcttactttctgggatgccaggctttataaaatggcggtt
ggtttcatgctcgctcatccgtacgggttcacacgggtgatgtcaagttatcgttggcca
agatatttcgaaaacggagtggatgttaacgactgggtgggaccaccaagtaactcggac
ggatcgacgaagtccgttacaatcaacgcagacactacctgtggcaatgactgggtctgc
gaacatcgctggcgacaaataaggaacatggttatcttccgtaatgtggtagacggtcag
cctttctcaaactggtgggacaacgggagcaatcaagtagctttcggtcgcggcgacaga
ggcttcattgtctttaataatgatgactggtatatgaatgtcgatttgcaaactggtctg
cctgctggaacctactgcgatgttatttctggacaaaaggaaggcagtgcgtgtactgga
aagcaggtgtacgtttcctcggatggaaaggccaatttccagattagtaacagcgatgaa
gatccatttgttgcaattcacgttgatgccaagttataa

DBGET integrated database retrieval system