KEGG   Gallus gallus (chicken): 414743
Entry
414743            CDS       T01006                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha precursor
  KO
K08774  transforming growth factor, alpha
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    414743 (TGFA)
   04012 ErbB signaling pathway
    414743 (TGFA)
SSDB
Motif
Pfam: DUF1180 DAG1
Other DBs
NCBI-GeneID: 414743
NCBI-ProteinID: NP_001001614
CGNC: 16955
UniProt: Q6J1M9
LinkDB
Position
22
AA seq 156 aa
MPGEAAALALGVLVAVCHALENTTSALSDPPVAAAVRSHFNECPDSHRQFCFHGTCRFLV
QEDKPACVCHSGYVGTRCEHADLLAVVAANQKKQTITALLVVAVVASAVLIAACVLVHCC
RMRKRCGCCRVPLCGQEKPSGLLKGGASCCHTESVV
NT seq 471 nt   +upstreamnt  +downstreamnt
atgccgggagaggcggccgcgctggcgctgggcgtgctggtggctgtgtgccatgccctg
gagaacacaacgtcagcgctgagcgatccccccgtggcagcggccgtgcggtcacacttc
aatgagtgccccgactcccaccggcagttctgcttccatgggacgtgccgcttcctggtg
caggaggacaagccggcgtgtgtgtgccactcgggctacgtggggacgcgctgtgagcac
gccgacctgctggccgtggtggctgccaaccagaagaagcagacgatcaccgcactgctg
gtggtggccgtggtggcctcggcggtgctcatcgccgcctgcgtgctcgtccactgctgc
cggatgaggaagcgctgcgggtgctgccgggtgccgctctgcgggcaggagaagccatcg
gggctgctgaagggaggagcgtcctgctgccatactgagagtgttgtctga

DBGET integrated database retrieval system