KEGG   Gallus gallus (chicken): 416330
Entry
416330            CDS       T01006                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4 precursor
  KO
K05430  interleukin 4
Organism
gga  Gallus gallus (chicken)
Pathway
gga04060  Cytokine-cytokine receptor interaction
gga04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    416330 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    416330 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gga04052]
    416330 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    416330 (IL4)
Cytokines and growth factors [BR:gga04052]
 Cytokines
  Interleukins
   416330 (IL4)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate / Haparin
  Cytokines
   416330 (IL4)
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 416330
NCBI-ProteinID: NP_001007080
CGNC: 50227
Ensembl: ENSGALG00000006827
UniProt: Q5W4U1
LinkDB
Position
13
AA seq 136 aa
MSSSLPTLLALLVLLAGPGAVPTLCLQLSVPLMESIRIVNDIQGEVSCVKMNVTDIFADN
KTNNKTELLCKASTIVWESQHCHKNLQGLFLNMRQLLNASSTSLKAPCPTAAGNTTSMEK
FLADLRTFFHQLAKNK
NT seq 411 nt   +upstreamnt  +downstreamnt
atgagctcctcactgcccaccctgctggcactgctggtgctgctggccggccctggggct
gtgcccacgctgtgcttacagctctcagtgccgctgatggagagcatccggatagtgaat
gacatccagggagaggtttcctgcgtcaagatgaacgtgacagatatctttgcagacaat
aagacaaataacaaaactgagctcttatgcaaagcctccacaattgtttgggagagccag
cactgccacaagaacctgcagggtctcttcctcaacatgcgtcagctcctgaatgccagc
agcacctccctcaaggcaccatgtcccacggcagcaggcaacactacttcaatggagaag
ttcctagcagacctacgtaccttcttccaccaactagctaaaaataagtga

DBGET integrated database retrieval system