KEGG   Gallus gallus (chicken): 416343
Entry
416343            CDS       T01006                                 

Gene name
NR3C1
Definition
(RefSeq) glucocorticoid receptor
  KO
K05771  glucocorticoid receptor
Organism
gga  Gallus gallus (chicken)
Pathway
gga04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    416343 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    416343 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:gga03310]
    416343 (NR3C1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    416343 (NR3C1)
Nuclear receptors [BR:gga03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   416343 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 416343
NCBI-ProteinID: NP_001032915
CGNC: 5586
Ensembl: ENSGALG00000032992
UniProt: Q38HX7
LinkDB
Position
13
AA seq 772 aa
MDSKELLKSSDQDETRKNALMSTKGGIVMDFHPPFRGGASAQAPVSAAPLPVSSQSDSAQ
QPALADFSKGLVNNVPPPDLSKAVSLSMGLYMGETDAKVMGNDLGFSQQGQTGISSGETD
FRLLEESIASLNKSSSLAEDAKGAVSSEAPLEPDFVGMAGRGPLEPGASVQSQVGSNGGS
LKLSSEDQSTLDILQDLELPSVSPGKEPNGSPWRLDPLLDDGGLLSPISADDTFLLEGNL
GEDCKPPILSDTKPKINDRGDLLPSSKMPMPQVKTEKEDFIELCTPGIKQENVGPIYCQA
NFSGSNMLGTKVSAISIHGVSTSGGQMYHYDLNTASLSQQQDQKPIFNIIPSLPAGSENW
NRCQGSGDEALAPLGTLNLSGRPAFSNGYSSPGLRSDVSSSPSTTSATAGPPPKLCLVCS
DEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAG
MNLEARKTKKKIKGIQQTTATGTREAAEAAGNKSVVPASLPQLTPTLVSLLEVIEPEVLY
SGYDSTLPDSSWRIMSTLNMLGGRQVVAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMA
FALGWRSYKQSNGNLLCFAPDLIINEQRMNLPCMYEQCKHMLMVARELSRLQVSYEEYLC
MKTLLLLSTIPKEGLKSQTLFEEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSM
HDVVENLLSFCFQTFLDKSMSIEFPEMLAEIISNQIPKYSNGNIKKLLFHQK
NT seq 2319 nt   +upstreamnt  +downstreamnt
atggattccaaagaattgcttaagtcgtcagaccaagacgaaaccaggaaaaatgcgctc
atgagtaccaaaggagggatcgtgatggacttccatccgcccttcaggggtggagcctct
gcacaagcccctgtatctgcagctcctctcccggtgtcttctcagtcagactctgctcag
caacctgctctggctgacttctcaaaaggattggtaaacaatgtgcctccgccagacctg
tccaaggcagtgtcgctatccatgggactgtatatgggtgaaacagatgcgaaagtgatg
ggaaacgaccttggattttcacagcagggccaaactggcatctcttctggagaaacggac
ttcaggctcctggaggaaagcattgcaagcttgaacaagtcctcgagcctggcggaggac
gcgaagggagcagtgtcgtccgaggcgccgctggagccggactttgtgggcatggctggc
cgcgggcccctggagccgggggcttcggtccaaagccaggtcggctccaatggcggcagc
ctgaagctgtcctctgaagaccaaagcaccctggatatcctccaggatttggaattgcca
tcggtatcgcctggcaaagagccgaatgggagtccgtggcggctggacccgttgctcgat
gacggaggcttgctgtcccccatctccgctgacgacacgttcctcctggagggaaacctg
ggggaagactgcaagccccccattttgtctgacactaaacctaaaattaatgaccgtggt
gaccttttacccagttccaaaatgccgatgcctcaagtgaaaacggaaaaggaagacttc
attgaactctgtactcctggcataaagcaagaaaacgtgggcccaatttactgtcaggca
aacttctccgggtctaatatgctgggtactaaagtctctgccatctctatccatggtgtc
agcacctctgggggacagatgtatcactatgatttaaatactgcatccctctctcagcag
caggatcagaaaccaatttttaatatcattccatctcttcctgccggttcagaaaattgg
aataggtgccagggatcaggggacgaggctttagctcccttgggaacgctcaacctttct
ggcagacctgctttctctaatggctattcaagccctggactgagatcagatgtaagctct
tctccatccacaacctcagcgactgcgggaccacctcccaagctctgcctcgtatgctct
gacgaggcctctgggtgccattatggtgttcttacttgtggcagctgcaaagtgttcttc
aaaagagccgtggaagggcagcacaactatctctgcgctggaaggaacgattgcattatt
gacaaaattcggcggaagaactgcccggcgtgccgctatcggaaatgtctccaggcaggc
atgaacctcgaagctcgcaagacgaagaagaagataaaaggcattcagcagaccactgcc
acgggcacgagggaagctgccgaagctgctggaaataagagcgtggttcccgcgtcgctg
ccgcagctcacacccaccctggtgtcactgctggaggtgatcgagccggaggtgctgtac
tcaggctatgacagcacgctgcccgactccagctggcgcatcatgtcaaccctcaacatg
ttaggaggacggcaagtggtagctgcggtcaagtgggcaaaggcaataccaggtttcaga
aacttacacctggatgaccaaatgacccttctgcagtactcctggatgttcctaatggct
tttgctttaggatggaggtcatacaaacaatcaaatggaaatctcctgtgctttgcacca
gatctgattattaatgagcagagaatgaatctaccctgtatgtatgaacaatgcaaacat
atgctgatggttgctcgcgagctgtcacggctgcaagtctcatatgaagagtatctctgc
atgaaaacgttgcttctcctctctacaattcccaaggaaggcctgaagagccaaactttg
tttgaagaaattcgcatgacatacataaaagagctgggaaaggccatcgtgaaaagagaa
gggaactcaagccagaactggcagcggttctatcagctgacgaagctgttggactctatg
cacgatgtggttgaaaatcttctgagcttttgcttccagacgtttttggataaatccatg
agtattgagttcccagaaatgttggcagaaatcatcagcaaccagataccaaaatactca
aatggaaatataaagaagctcttatttcatcagaagtga

DBGET integrated database retrieval system