KEGG   Gallus gallus (chicken): 416462Help
Entry
416462            CDS       T01006                                 

Gene name
GAAGSD
Definition
(RefSeq) lysosomal alpha-glucosidase isoform X1
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00052  Galactose metabolism
gga00500  Starch and sucrose metabolism
gga01100  Metabolic pathways
gga04142  Lysosome
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    416462 (GAAGSD)
   00500 Starch and sucrose metabolism
    416462 (GAAGSD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    416462 (GAAGSD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    416462 (GAAGSD)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     416462 (GAAGSD)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   416462 (GAAGSD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110 RL11D
Motif
Other DBs
NCBI-GeneID: 416462
NCBI-ProteinID: XP_015149821
CGNC: 3070
Ensembl: ENSGALG00000039611
LinkDB All DBs
Position
14
AA seq 932 aa AA seqDB search
MTMRSYQKLRTAVPQLVLSQEEEEESAATPTPAGRSKLAPWWVGSGLLITAVLLSTITVW
VLRQVSRGWHGPAPPSQCHLVPESHRYDCYPERSVVVTQELCESRGCCFIETPPAVGGKR
GVPWCFYPPSFPSYVVQSLNQTALGMTGLLVRREKAYYPKDIQVLRMDVEFQTNTRLRIK
ITDAAKPRYEVPLEVPRVMKRAENPIYSLEFSQDPFGVLLRRQGTGTVLLNTTVAPLIFA
DQFLQISTTLPSRFLYGLGEHRSTLLHSLDWNTLTLWARDVAPTESFNLYGAHPFYLLME
EGGDAHGVFLLNSNAMEVALQPAPGLTWRTIGGVLDFYIFLGPDPNMVIQQYQEVIGFPA
MPPLWALGFHLCRWGYGSSNETWQTARAMRNFQIPQDAQWNDIDYMDGYRDFTFDPQKFA
SLPSLVEDLHKHGQHYVMILDPGISSTSPHGSYWPFDEGLRRALFLNTTQGQPLIGQVWP
GYTAFPDFSNRDTHQWWLENLQRFHTRVPFDGLWIDMNEPSNFMDGSEEGCPPGELDSPP
YTPAVLGNSLSAKTVCASAKQNASVHYNLHNLYGLKEAEATASALIHIRGKRPFVISRST
FPSQGRYSGHWLGDNRSQWKDMYYSIPGMLSFSLFGIPLVGADICGFSGSTSEELCTRWM
QLGAFYPFSRNHNTQNEKAQDPTAFSPSARTAMKDVLLTRYSLLPFLYTLFHRAHLQGET
VARPLFFEFPWDVATYGLDRQFLWGQSLLVTPVLEPGADSVLGYFPRGVWYDFYTGSSVN
SSGEMLKLSAPLDHLNLHLREGSILPTQKPGTTSKATRGNPLRLIVALSPRATAWGDLFW
DDGESLDTFERGNYSYLVFNATENIFTSNVLHASTEATYVTIDTVSFYGMQEPPSKVLLD
GQEKPFSYLDNQVLTVSGLGLRLSQGFSLQWL
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgaggtcgtaccagaagctgaggacggcggtgccgcagctggtgttgagccag
gaggaggaggaggagagtgcggccaccccaacacctgctggccgcagcaagctggccccg
tggtgggtgggcagcgggctgctgatcaccgccgtgctgctgagcaccatcactgtctgg
gtgctgcgacaggtgtccaggggctggcacggccccgcaccaccttcccaatgtcacctg
gtccctgagagccaccgctatgactgctaccccgaaaggagcgtggtggtgacccaggag
ctgtgcgagagccgggggtgctgcttcatcgagaccccccctgcagtggggggcaagagg
ggggtgccctggtgcttctacccacccagcttccccagctacgtggtgcagagcctcaac
cagacggcgctgggcatgacggggctgctggtgcgcagggagaaggcctattaccccaag
gacatccaggtgctgaggatggacgtggagttccagacgaacacacggctgcgcatcaag
ataaccgatgcagccaagccccggtatgaggtgcccctggaagttccccgagtgatgaag
agagcagaaaaccccatctacagcctggagttctcccaggacccctttggggtgctgctg
aggcgccaagggacagggacagtgctgctcaacaccaccgtggctcccctgatcttcgcc
gatcagttcctgcagatctccaccacgctgccctccaggttcctgtatgggctgggggag
caccgcagcactctgctgcacagcctcgactggaacaccctcaccctctgggcccgtgat
gtggcccccacggaatccttcaacctgtacggcgctcaccccttctacctgctgatggag
gagggcggcgatgcccacggggttttcctcctcaacagcaacgccatggaggtggccctg
cagcctgccccgggcctgacttggaggaccattggaggtgtgctggacttctacatcttc
ctggggcctgaccccaacatggtcatccagcagtaccaggaggtgataggtttcccagcc
atgcctccactctgggcgctcggcttccacctctgccgctggggctacggctccagcaac
gagacctggcagactgcaagggccatgaggaacttccagatcccacaggatgcgcaatgg
aacgacattgattacatggacgggtaccgggacttcaccttcgatccccagaaattcgcc
tccctcccctcactggtggaagatctccacaagcacgggcagcactacgtgatgatcttg
gaccccggcatcagcagcaccagcccccacggctcctactggcctttcgatgaaggcttg
agacgtgctttgttcctgaacaccacccaggggcagccactgatcgggcaggtctggcct
ggttatactgccttccccgacttctccaacagagacacacatcagtggtggctggagaac
ctgcagcgcttccacacccgtgtgcccttcgatggcctctggatcgacatgaacgagcca
tccaacttcatggatgggtctgaagagggctgcccacccggagagctcgacagccccccg
tacacgccggctgtgctgggcaattccctgtccgccaagacggtgtgtgcctcagcgaag
cagaacgcctcggtgcactacaacctgcacaacctctacgggctgaaggaagccgaagcg
acggcgagcgccttgatccacatccgaggaaagcgtccctttgtcatctcccgctctacc
ttccccagccagggccggtactcgggtcactggctgggtgacaaccggagccagtggaag
gacatgtattactccatcccagggatgctgagcttcagcctgtttgggatcccactggtg
ggggccgacatctgcggcttctccggcagcacctcggaggagctgtgcacccgctggatg
cagctcggggccttctaccccttctcccgcaaccacaacacccagaacgagaaggcccag
gaccccacagctttcagcccctcggcgaggacagccatgaaggacgtactgctcacccgc
tactccctcctgcctttcctctacacacttttccaccgtgcccacctgcaaggggaaacc
gttgcccgacctttgttctttgagttcccctgggatgtggccacgtatgggctggacagg
cagttcctgtggggccagagcctgctggtgacaccggtgctggagcccggagcagactcg
gtgttgggctatttcccccgaggcgtgtggtacgacttctacacgggctcctctgtgaac
agcagtggggagatgttgaagctgtcagcccccctggaccacctcaacctgcatctccgg
gagggttctatcctgcccacacagaaacccgggaccaccagcaaggccacccgagggaac
ccgctgcgcctcattgtggccctgtccccacgtgccactgcctggggggacctcttctgg
gatgacggcgagagcctggacaccttcgagcggggcaactactcctacctggtgttcaat
gccacagagaacatcttcacctccaacgtcctccatgccagcaccgaggccacctatgtc
accatcgacacggtgagcttctacggaatgcaggagccgcccagcaaggtcctcctggat
gggcaggagaagcccttctcctacctggacaaccaggtcctcacggtcagcggcctcggc
ctcaggctcagccagggcttctccctgcagtggctgtga

DBGET integrated database retrieval system