KEGG   Gallus gallus (chicken): 416796Help
Entry
416796            CDS       T01006                                 

Gene name
GALNT9
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9 isoform X5
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00512  Mucin type O-glycan biosynthesis
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    416796 (GALNT9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gga01003]
    416796 (GALNT9)
Enzymes [BR:gga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     416796 (GALNT9)
Glycosyltransferases [BR:gga01003]
 O-Glycan biosynthesis
  Mucin-type
   416796 (GALNT9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 416796
NCBI-ProteinID: XP_004945569
CGNC: 1602
Ensembl: ENSGALG00000002242
LinkDB All DBs
Position
15
AA seq 460 aa AA seqDB search
MTYPDDLPQISVVFIFVNEALSVILRSVHSVVNHTPSHLLKEIILVDDNSDNVELKFNLD
QYVHKRYPGLVKIVRNNKREGLIRARIQGWKAATSPVVGFFDAHVEFNIGWVEPALTRIK
EDRKRIILPAIDNIKYNTFEVQQYANAAHGYNWGLWCMYIIPPQDWLDKGDESAPIRTPA
MIGCSFVVDREYFGEIGLLDPGMEVYGGENIELGMRVWQCGGSMEVLPCSRVAHIERTKK
PYNNDIDYYAKRNALRAAEVWMDDFKSHVYMAWNIPMANPGVDFGDVSERIALRQRLQCR
SFKWYLENVYPEMRVYNNTVTYGEVRNSKASGYCLDQGAEEDDKAILYPCHGMSSQLVRY
SSDGVLQLGPLGSTAFLPDSKCLVDDGKGRTPTLKKCEDVLRPAQRFWDFTQNGPIISRD
TGRCLEVEMSKDANFGLRLVVQRCSGQKWMIRNWIKHGRH
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgacctacccagatgacctgccccagatctctgtggtctttatatttgttaatgaggcg
ctgtctgtcatcctgcgctccgtgcacagtgttgtgaatcacaccccctcgcatttgctc
aaagagatcattctggtggatgacaacagtgacaatgttgagctcaaatttaacctggac
cagtatgtccataaaagatacccaggtctggtgaaaatagtgcgcaataacaaacgagaa
ggactgattcgagccagaattcaaggctggaaagctgcaacctctcctgttgttgggttc
tttgatgctcacgtggaattcaacattggctgggtggaacctgcgcttacccggatcaaa
gaagacagaaagcggatcatcttgccagcaatcgacaacatcaagtacaacacatttgaa
gtgcagcaatacgccaatgcagcccatggctacaactggggcctctggtgcatgtacatc
atcccaccacaggactggctcgataaaggggacgagtcagcacccatcaggacaccagcc
atgattggatgctcatttgtagtagaccgagagtattttggtgagattggcttgcttgac
cctggcatggaggtctatggaggagagaacattgaattgggcatgagggtctggcaatgt
ggaggaagtatggaggtgctaccctgctctcgtgtggcacacatcgaacgcacaaagaaa
ccctacaacaatgacattgattactatgcaaagcgcaatgccctacgggctgcagaggtc
tggatggatgacttcaagtcccatgtttacatggcgtggaacatccccatggcaaaccct
ggagttgattttggagatgtttctgaaagaatagctctgcgacagagactgcagtgccgg
agctttaagtggtacttggagaacgtctatcctgaaatgagagtctataataacacagtc
acttacggagaggtgcgtaacagcaaagctagtggctactgcttggatcagggagctgaa
gaggatgacaaagcaatcctttatccatgccatggaatgtcctctcagctcgttcgctac
agctctgatggcgtcctgcagctggggccgctgggctccaccgccttcctgcctgactcc
aaatgcctcgttgatgacgggaagggcaggacaccgactctgaagaagtgtgaagatgtc
ctgagaccagcacagaggttctgggattttacacagaacggtccaatcatcagcagagac
actggccgttgtctagaagtggaaatgtcaaaggatgcaaattttgggctcagattagtt
gtacaaaggtgctcggggcaaaaatggatgattagaaactggataaaacacggccgacat
tga

DBGET integrated database retrieval system