KEGG   Gallus gallus (chicken): 417480Help
Entry
417480            CDS       T01006                                 

Gene name
WBSCR17
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 17 isoform X1
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00512  Mucin type O-glycan biosynthesis
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    417480 (WBSCR17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gga01003]
    417480 (WBSCR17)
Enzymes [BR:gga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     417480 (WBSCR17)
Glycosyltransferases [BR:gga01003]
 O-Glycan biosynthesis
  Mucin-type
   417480 (WBSCR17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin RicinB_lectin_2
Motif
Other DBs
NCBI-GeneID: 417480
NCBI-ProteinID: XP_415728
CGNC: 765
Ensembl: ENSGALG00000001130
UniProt: E1BVE9
LinkDB All DBs
Position
19
AA seq 662 aa AA seqDB search
MKLRPSGAGGPGCVSPAGRRLSERLRSRPGAAPAQPCDVRAAARTCPAGPLARRGGGRCP
SGSLMASLRRVKVLLVLNLIAVAGFVLFLAKCRPITAKSGDSFHDIHPRAEVVNLTARGI
SSIQDAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPEEEEKAKGPHE
KYGYNSYLSEKISLDRSIPDYRPTKCKELKYGKDLPQISIIFIFVNEALSVILRSVHSAV
NHTPAHLLKEIILVDDNSDEEELKAPLEEYVNKRYPGLVKVVRNQKREGLIRARIEGWKA
ATGHVTGFFDAHVEFTAGWAEPVLSRIQENRRRVILPSIDNIKQDNFEVQRYENSAHGYS
WELWCMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVHRKFFGEIGLLDPGMDVYGGENIE
LGIKVWLCGGSMEVLPCSRVAHIERKKKPYNNNIGFYTKRNALRVAEVWMDDYKSHVYIA
WNLPLENPGIDIGDVSERKALRKSLKCKNFQWYLDHVYPEMRRYNNTVAYGELRNNKAKD
VCLDQGPQENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNVKSRFP
QLLDCDKVKSSLHKRWNFIQNGAILNKGTGRCLEVENRGMAGIDLILRSCTGQRWTIKNF
IK
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgcggccgagcggggcgggcggccccggctgcgtctcccccgcgggccgtagg
ctgagcgagcggctccgcagccggccgggcgcagctcccgcgcagccgtgcgatgtgcgc
gcagcggcacgcacctgcccggccggtcccttagcgcggcgcggcggcgggaggtgcccc
tcgggaagtttgatggcttctttgaggagagtcaaagtgctgctggtgttaaacttgatc
gccgtggctggcttcgtcctcttcctggccaagtgcagacccatcacggccaagagcggc
gattcctttcatgacatccatcccagggcagaagtggtcaacttgacggcccgcggcatc
agctccatccaggacgcggtgctgaagaggctctccctcctggaggacatcgtctacaga
cagctcaatggtctgtccaagtcactcggtctcattgaaggctacggtggacgtggcaaa
gggggacttccagccaccctgtcccccgaggaggaggagaaagcaaagggaccccatgag
aaatacggctacaactcctacctcagtgagaaaatttcactggaccgttccataccagat
tatcgtccaaccaagtgcaaagagctgaagtacggcaaggacctgccccagatctccatt
atcttcatcttcgtcaacgaggcgctctcggtcatcctgcggtcggtgcacagcgctgtc
aatcacaccccggcccacctgctgaaggagatcatcctcgtggacgacaacagcgatgaa
gaggaactgaaggcaccgctggaggagtacgtcaataagcgctacccggggctggtgaag
gtggtgcgcaaccagaagagggaaggcctcatccgagcgcgcatcgaaggctggaaggcg
gccaccggccacgtcaccggcttctttgatgcccacgtggagttcactgctggctgggct
gaaccagtgctttcacggattcaggaaaaccgaagaagagtcatccttccctccatagac
aacatcaagcaggacaactttgaggtgcagcgttacgagaactcagcccacgggtacagc
tgggagctgtggtgcatgtacatcagcccccccaaggactggtgggacgccggggacccc
tcactgcccatcaggacgccagcgatgatcggttgctcctttgttgtgcacaggaagttc
tttggagagattgggctcctcgatcccgggatggacgtgtatggaggggagaacatagag
ctcggcatcaaggtgtggctgtgcggcggcagcatggaagtcctgccctgctccagggtg
gcccacatcgaacgcaagaagaagccctacaacaacaacattggtttctacaccaaacgt
aacgccctgcgagtggccgaggtgtggatggatgactacaagtcccatgtgtacatcgcg
tggaatttgcctctggagaatccgggtattgacatcggggatgtctccgagagaaaagcc
ttaaggaagagcttgaagtgtaagaatttccagtggtatctggaccacgtttatccagaa
atgagaagatacaacaacactgttgcgtatggcgagcttcgaaacaacaaggcaaaagat
gtctgccttgaccagggcccgcaggagaaccacacagcaatattgtacccgtgccatggc
tggggaccgcagcttgcacgctacaccaaggaggggttccttcaccttggtgcccttggg
accacgacgctcctgcccgacacccgctgcctggtggacaacgtgaagagccgcttccct
caactcctcgactgtgacaaggtcaagagcagccttcataagcgctggaatttcatccag
aacggtgccatcctgaacaagggaacagggcgctgcttggaggtggagaacaggggaatg
gccggcatcgatctgatccttcgcagctgcacaggacagaggtggacaattaaaaatttc
atcaagtaa

DBGET integrated database retrieval system