KEGG   Gallus gallus (chicken): 417691Help
Entry
417691            CDS       T01006                                 

Gene name
SIIL
Definition
(RefSeq) sucrase-isomaltase, intestinal
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00052  Galactose metabolism
gga00500  Starch and sucrose metabolism
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    417691 (SIIL)
   00500 Starch and sucrose metabolism
    417691 (SIIL)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     417691 (SIIL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 417691
NCBI-ProteinID: XP_015131243
CGNC: 50572
LinkDB All DBs
Position
1
AA seq 856 aa AA seqDB search
MPVARRVNCHPQPGATQQSCEARGCTWCATDVPNAPWCFFSEDSSYGYSLTRSMEKTAKG
WRVTLDKRSTVSLFGDDISPIVLDVEFQTKDRLRFRMYDPSQKRFEVPLSIDSPGVAAED
ANYDVQFSSDSSHFQVKRKSTGTVLWDSPLVDLFFSNQYLQITTAVPSTSVYGFGEQEHV
SFKHNMDFVTYGMFSRDQPPTPLANLYGVHPFYMCVEDDSNAHGVLLLNSNAQDVSLSPN
PSLTFRTIGGILDFYVFLGPTPENVIQQYTEAIGRPHMPAYWSLGFHLSRWGYASLDVVK
NTAKRMHHYDIPFDVQHFDIDYMDRRLDFTYDKTNYAGLPEYIKELKTAGMHSVIILDPF
ISKDEEPGTYRPYDLGQEMGVWINNSDGVTPAIGKSLPPGYSVFPDYTNPRTVEWWTQLC
LEFKDVLDYDGIWIDMNEPSNDLTGQLPGCAANDINDPPYIPSITDHSLAQKTLCPDSRT
YLGEHYNTHSLFGWSQTAPTFHVVQQATGKRAFVLSRSTFVGSGKHAGHWLGDNKSQWKD
MHYSIIGMLEFNLFGIPFVGADICGFSSNTTYELCLRWMQLGSFYPFSRNHNAEGNAAQD
PAVFGAEFAKIARATLRIRYSLLPYLYTLFFESHVHGNTVVRSLMHEFTSDQQTHGIDTA
FLWGPAFMVAPVLQEGARSVDVYFPEATWFDYYTGRKIPSTWHKTYATVYAPLNKIPLFI
RGGHILPEQAPASTTTKSRLNPFGLIIALDEHGEASGSLFWDDGDSIDTIENENYFLAKY
TFSAGHLKTEILKNGYRGADSLKYNKITILGLKLRPHAVAVNGRAVRRDAFSYELNGKLV
LGISAPLTHELNLAIY
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atgccagtagcgagacgagtgaactgccacccccagcccggcgcgacccagcagagctgc
gaggcacgtggctgcacctggtgtgccaccgacgtccccaatgctccctggtgcttcttc
tctgaggacagcagctatggctactcactgaccaggagcatggagaagacagcgaaaggc
tggagggtgacgctggacaagcgcagcacggtgtccctgtttggtgatgacatctctccc
attgtgttggatgtggagttccagacgaaggacaggctcaggtttaggatgtacgacccc
agccagaagcgcttcgaggtgcccctcagcatcgattccccaggggtggccgctgaggat
gccaactatgatgtgcagttctcatctgactcctcacacttccaagtgaagaggaagagc
accggcacagtgctgtgggacagtcccctggttgatctgtttttctccaaccagtacctt
cagattaccacagctgtgccatccacctcggtgtacgggtttggtgagcaggagcatgtg
tccttcaaacacaacatggactttgttacctacggcatgttcagcagggaccagccaccc
acgccacttgccaatctctatggcgttcaccctttctacatgtgtgtagaggatgactcc
aatgcccacggtgttctccttctgaactccaatgcacaagatgtttctctgagtccaaac
ccgtctttaactttccgcactattggagggatccttgacttctatgtcttccttggtccg
actcctgaaaatgtcattcagcaatacacagaggccattggacgcccacacatgcctgcc
tactggtctctgggattccacctgtcccggtggggttacgccagccttgatgtcgtaaag
aacactgccaaacgcatgcaccactatgatatcccctttgatgtccagcatttcgatatc
gactacatggatcgtcgcctggacttcacctatgacaaaacgaattatgcgggtctgccc
gagtacatcaaagagctgaagacagcaggaatgcacagtgtcattattctggatccattt
ataagcaaggatgaagaaccaggtacttacaggccgtatgacctcggacaggaaatggga
gtctggataaacaactccgatggcgtaactcctgctattggaaagtccttgcctcccgga
tactcagtgtttcctgactacaccaaccccaggacagtggaatggtggacccagttgtgt
ctggagtttaaggatgtccttgactacgatgggatctggattgatatgaatgaaccatcc
aatgacttaacaggccaacttcctggatgcgctgctaatgatatcaatgaccctccttac
attcctagcattactgatcactccctggctcaaaagactctgtgccctgactccaggact
tacctgggggagcactacaacacgcactctctctttggctggtcacagactgctccaact
ttccacgttgtccagcaggcaactgggaagcgggcgtttgtcctgagtcggtccaccttc
gtgggcagcgggaagcacgctggtcactggctgggtgacaacaagtcgcagtggaaggac
atgcactactccatcatcggcatgctggagttcaacctctttggcattccctttgttggt
gccgacatctgtgggtttagctccaacacaacctacgagctctgtttgcgctggatgcag
ctcggctccttctacccattttccagaaaccacaacgcagagggaaatgctgctcaagac
ccagcagtctttggagcagagtttgccaagatagctcgagctacgctccggatcagatac
tccctgctcccatacctctacaccttgttctttgagtctcacgtccatggcaacacggtg
gtgcggtcgctgatgcatgaatttacctctgatcagcagactcatgggatagatactgcc
ttcctttggggacccgcgtttatggttgctcctgttcttcaagagggagcgagatcagtg
gatgtgtatttccccgaggcaacatggtttgactactacacaggtaggaaaataccaagt
acttggcacaagacatatgctactgtctacgccccactgaacaagatccctctgttcatc
cgcggaggccatattctgccagaacaggctccagcctcaacaactaccaagagccgtctg
aacccatttgggctcattatcgccctggatgagcacggagaagcttctgggtctctcttc
tgggatgatggtgattccatcgatactattgaaaatgaaaactacttcttggctaaatat
acattcagcgcaggacacctgaagacagaaatacttaaaaatggttaccgaggggctgac
tctctgaagtacaacaaaatcaccattcttggcctgaaactgagacctcatgctgttgct
gtgaacggaagggctgtccgtagagatgccttctcctatgagctgaatgggaaactcgtt
ttggggatttctgccccacttactcatgaactcaacctggcaatttattaa

DBGET integrated database retrieval system