KEGG   Gallus gallus (chicken): 418178Help
Entry
418178            CDS       T01006                                 

Gene name
MGST1
Definition
(RefSeq) microsomal glutathione S-transferase 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00480  Glutathione metabolism
gga00980  Metabolism of xenobiotics by cytochrome P450
gga00982  Drug metabolism - cytochrome P450
gga00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    418178 (MGST1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    418178 (MGST1)
   00982 Drug metabolism - cytochrome P450
    418178 (MGST1)
   00983 Drug metabolism - other enzymes
    418178 (MGST1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gga02000]
    418178 (MGST1)
Enzymes [BR:gga01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     418178 (MGST1)
Transporters [BR:gga02000]
 Other Transporters
  Pores ion channels [TC:1]
   418178 (MGST1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG Anoctamin
Motif
Other DBs
NCBI-GeneID: 418178
NCBI-ProteinID: NP_001129022
CGNC: 9903
Ensembl: ENSGALG00000013098
UniProt: B4X9P5
LinkDB All DBs
Position
1
AA seq 155 aa AA seqDB search
MAKSTQLIDNEVFRAYATYAAIVLLKMMLMSLVTAYFRITRKAFANPEDTASFGKGDSAK
KFLRTDADVERVRRGHLNDLENIVPFFGIGLLYALCGPDLSTALLHFRIFAGARILHTFA
YLIPLPQPSRGLSWAAGYAVTISMAYKVLSKALYL
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggctaaatcgacccagctaattgacaatgaagtcttccgtgcttatgctacctatgca
gccattgttcttctaaaaatgatgcttatgagccttgtaactgcatacttcagaatcacg
agaaaggcatttgccaacccagaagatacagcatcatttggtaaaggtgacagtgctaaa
aaattcctgcggactgatgcagatgttgaacgtgtacgcagaggccacctgaatgacctt
gaaaacattgtcccattttttggcattggactgctgtatgctctctgtggccctgatctg
tccacggccttgctgcattttaggatcttcgcaggggcaaggatccttcacactttcgca
tacttgatccctcttccccagcccagtagaggtttgtcttgggcagctggttatgcagtt
accatctcaatggcatacaaagtgctgagtaaagcattgtacctgtag

DBGET integrated database retrieval system