KEGG   Gallus gallus (chicken): 418244Help
Entry
418244            CDS       T01006                                 

Gene name
RIBC2
Definition
(RefSeq) RIB43A-like with coiled-coils protein 2
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif
Pfam: RIB43A
Motif
Other DBs
NCBI-GeneID: 418244
NCBI-ProteinID: XP_416468
CGNC: 10606
Ensembl: ENSGALG00000014232
LinkDB All DBs
Position
1
AA seq 471 aa AA seqDB search
MVCLLEGGTGRKKALSVRWNAEAQKNARPKAHPPHLAPQRPTHNAATGLVPAAVRPRLIG
QRALGGGGSSSPWRPGVLCLGGDRRRLRFLPAMSGLRVQRDLQEAAALERRRQRELQRQG
RIFNARVRTIGVDKDALDAQVKDRKIQEATEKARNEELANEMKQNDKMMCMLEEQQKRNI
RNINKAVSDFQKNFQKPETRREFDLSDPQALKKDRPARLSDNDPRCTVSGLQKFMGEDLN
YAQRTKFQKEQLREWSLQQQRDHKNALADKKFLDDLHDKNRIELDRKTMEQQRIEEETRR
AVCAATKDFNKSQAAEVAERKTLDKRQKMKEDMDEISSLLQGNLLSENPAQAISSFGTHR
VITDRWKGMSQDQLMAIRSFQQQQVLEKLRLKEEERHRDAEWDRQSMQAARAQLILERHQ
ERQNRERRQALDSINAQLSHEQKSKNIYLKEEEYSNCPTSQYFAQFNTTSR
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggtttgtcttctggaagggggcacagggaggaaaaaagccctcagcgtcaggtggaac
gctgaagcccaaaagaacgcgaggccgaaagcccacccaccgcacctcgcccctcagcgg
ccgacgcacaacgccgccaccggcctcgtgcccgcggccgtgcggcctcgcctgattggc
cagcgggctctgggagggggcgggagctcatctccatggcgacccggtgtgttgtgcctt
ggtggtgatcgtcgccgcttgcgctttttgccagccatgagcgggctgagggtgcagcgg
gacttgcaggaggcggctgctctggagcggcggcggcagcgcgagctgcagcggcagggc
cgcatctttaacgcgagagttcggaccatcggggttgataaagatgcgttggatgcccag
gtcaaggataggaaaattcaagaagcaactgaaaaagcacgaaatgaagaacttgctaat
gaaatgaagcaaaatgacaagatgatgtgtatgttagaagaacaacagaaacgcaatatc
agaaacataaacaaggctgtcagtgactttcagaagaatttccagaagccagaaacaaga
cgtgaatttgatctatctgatccccaggctttaaagaaggatagacctgctcggctttca
gacaacgatcctcgatgcactgtatctggcttgcagaagtttatgggtgaagacttaaac
tatgctcagaggacgaaatttcaaaaggagcagttaagagagtggtctcttcagcaacag
agagatcacaagaatgcattagctgataaaaaatttttagatgatcttcatgacaagaat
aggattgaactggaccgaaagactatggagcaacaacgaatagaagaagaaactagacgc
gctgtttgtgcagctaccaaagactttaacaaaagccaggctgctgaagtagctgagaga
aagacgctggataagcgtcaaaaaatgaaagaagatatggatgaaatttccagcctgctt
caaggaaacttactttctgaaaaccctgcgcaagccatcagttcctttggtacacatcgt
gtgatcacagataggtggaagggaatgagtcaggatcagttgatggcaatccgctccttt
caacagcaacaagttctggagaagctgagactaaaagaggaggaacgccacagagatgct
gaatgggacaggcaaagtatgcaggctgcaagagcacagttaattttagaacggcatcaa
gaacgacagaatcgggaacgccgccaagctctagatagcataaatgcacaactatcccac
gagcagaaatcaaagaatatttatcttaaagaagaagaatattcaaattgtccaacaagc
cagtacttcgcacagttcaatacaaccagtcgatga

DBGET integrated database retrieval system