KEGG   Gallus gallus (chicken): 419953Help
Entry
419953            CDS       T01006                                 

Gene name
ACE
Definition
(RefSeq) angiotensin-converting enzyme precursor
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:gga01002]
    419953 (ACE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    419953 (ACE)
   04090 CD molecules [BR:gga04090]
    419953 (ACE)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     419953 (ACE)
Peptidases [BR:gga01002]
 Metallo Peptidases
  Family M2
   419953 (ACE)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   419953 (ACE)
CD molecules [BR:gga04090]
 Proteins
  419953 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 Peptidase_M32
Motif
Other DBs
NCBI-GeneID: 419953
NCBI-ProteinID: NP_001161204
CGNC: 306
Ensembl: ENSGALG00000000498
UniProt: F1NYM0
LinkDB All DBs
Position
27
AA seq 1281 aa AA seqDB search
MPAALGLLLPWLSLVGALQPGLEPPQSDPTEAGAVFFASEYNSTAEIVLFRSVSASWEYN
TNLTTANAALQVEASLEEQNFTELWGKKAKELYGNIWSNFSDPQLKKIIGSIQTLGPSNL
PLDKRQQYNTILSDMDKIYSTAKVCLDNGTCWDLEPDISDIMATSRSYKKLLYAWEGWHN
AAGNPLRAKYQEFVTLSNEAYQMDGFEDTGSYWRSWYDSTTFEDDLEHLYNQLEPLYLNL
HAFVRRKLYDRYGPKYINLKGPIPAHLLGNMWAQQWNNIYDLMVPYPDKPNLDVTNTMVN
QGWNATHMFRVSEEFFTSLGLLEMPPEFWEKSMLEKPADGREVVCHASAWDFYNRKDFRI
KQCTTVTMEQLFTVHHEMGHVQYYLQYKDQPVSFRGGANPGFHEAIGDVLSLSVSTPSHL
QKIGLLSSAVEDEESNINYLLKMALEKIAFLPFGYLIDQWRWNVFSGRTPPSRYNYDWWY
LRTKYQGICAPVSRNESNFDPGAKYHIPGNTPYIRYFVSFILQFQFHKALCQAANHTGPL
HTCDIYMSKEAGAKLREVLKAGSSKSWQEILFNLTGTDKMDAGALLEYFSPVTTWLQEQN
NKTNEVLGWPEFDWRPPIPEGYPEGIDKIVDEAQAKEFLSEYNSTAEVVWNAYTEASWEY
NTNITDHNKEVMLEKNLAMSKHTIEYGMRARQFDPSDFQDETVTRILNKLSVLERAALPE
DELKEYNTLLSDMETTYSVAKVCRENNTCHPLDPDLTDILATSRDYNELLFAWKGWRDAS
GAKIKDKYKRYVELSNKAAVLNGYTDNGAYWRSLYETPTFEEDLERLYLQLQPLYLNLHA
YVRRALYNKYGAEHISLKGPIPAHLLGNMWAQSWSNIFDLVMPFPDATKVDATPAMKQQG
WTPKMMFEESDRFFTSLGLIPMPQEFWDKSMIEKPADGREVVCHASAWDFYNRKDFRIKQ
CTVVNMDDLITVHHEMGHVQYFLQYMDQPISFRDGANPGFHEAIGDVMALSVSTPKHLHS
INLLDQVTENEESDINYLMSIALDKIAFLPFGYLMDQWRWKVFDGRIKEDEYNQQWWNLR
LKYQGLCPPVPRSEDDFDPGAKFHIPANVPYIRYFVSFVIQFQFHQALCKAAGHTGPLHT
CDIYQSKEAGKLLGDAMKLGFSKPWPEAMQLITGQPNMSAEALMSYFEPLMTWLVKKNTE
NGEVLGWPEYSWTPYAVTEFHAATDTADFLGMSVGTKQATAGAWVLLALALVFLITSIFL
GVKLFSSRRKAFKSSSEMELK
NT seq 3846 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcggctctggggctgctgctgccgtggctcagcctggtgggtgccctgcagccg
gggctggaacccccccagtccgaccccaccgaagctggggccgttttcttcgccagtgag
tacaacagcacggcggagatcgtcctcttccgaagcgtgtcggccagctgggagtacaac
accaacctgacgaccgccaacgctgccctgcaggtcgaggcgtcgctggaggaacaaaac
ttcacagaactgtgggggaagaaagccaaagagctctatggcaacatctggagcaatttc
agtgacccacagctgaagaaaatcatcggatccatccagaccctggggccctccaacctg
cccctggacaagcggcagcagtacaacaccatcctgagcgacatggacaaaatatactcc
acggccaaggtgtgccttgacaatgggacctgctgggatctggagccagacatctcagac
atcatggccacctcccgcagctacaagaagctcctctacgcctgggagggttggcacaac
gctgcaggcaacccactgcgtgccaagtaccaggagttcgtgacgctgagcaacgaggcg
tatcagatggacggatttgaagacacaggcagctactggcgctcctggtatgactccacc
accttcgaggatgacctggagcatctctacaaccagctggagccactctacctcaacctg
catgcttttgtccgaagaaagctctacgaccgctatggccccaaatacattaacttgaag
ggccccatccctgctcacctcctcggtaacatgtgggctcagcagtggaacaatatctat
gatctaatggtcccctaccctgataagcccaacctggatgtcacaaacaccatggtgaat
cagggctggaatgccacccacatgttccgggtctcggaggagttcttcacctccctgggg
ctgctggagatgccacctgagttctgggagaagtccatgctggagaagccagcagatggc
cgggaagtggtgtgccatgcctcggcgtgggacttctacaaccgcaaggacttcaggatc
aagcagtgcacaacggtgaccatggagcagctgttcacggtgcaccacgagatgggccac
gtgcagtactacctgcagtacaaggaccagcccgtctccttccgcggcggggccaacccc
ggcttccatgaggccattggtgatgtcttgtccctgtctgtctccacccccagccacctt
cagaaaatcgggctcctcagcagtgctgtggaggatgaagagagcaacatcaactacctg
ctgaagatggccttggagaagattgccttcctgccctttggctacctcatcgaccagtgg
cgctggaatgtgttcagcggccgcacacccccgagccgttacaactatgactggtggtac
ctgagaaccaaataccagggtatttgtgctccagtttcgaggaatgaaagcaactttgac
cccggagcaaagtaccacatccctgggaacaccccttacatcaggtactttgtgagtttc
atcctccagttccagtttcacaaggcgctgtgccaggcggccaaccacaccggtcccctg
cacacctgtgacatctacatgtctaaagaggccggagccaaactcagggaggtgttgaag
gctgggtcttctaagtcatggcaggaaattctgttcaacctcactggtacggataagatg
gacgctggggcactcctggagtatttcagccctgtcaccacctggttgcaggagcagaac
aacaagaccaatgaggtgctgggctggcctgagtttgactggcgtccccccatccctgaa
ggctaccctgaaggcatcgacaaaatagtagatgaagcacaagctaaagagttcttgtcc
gagtacaacagcacagctgaggtggtgtggaatgcttacactgaggcatcttgggagtac
aacaccaacatcactgaccacaacaaggaagtcatgctggagaagaacttggccatgtcc
aagcacaccattgagtatggcatgagagcccggcagttcgacccctcggacttccaggac
gaaactgtcacccgcatcctcaataagctgagtgtgcttgagagggcagccctgccagag
gatgagctgaaggagtacaacaccctcctctcagatatggagaccacatacagcgtagcc
aaggtctgcagggagaacaacacttgccaccccttggatcctgacctcacggacatcctg
gctacctcacgagactacaacgagctcctctttgcctggaagggctggcgggatgcttct
ggggcgaaaatcaaggacaaatacaagcgatacgtggaactgagcaacaaggcagctgtg
ctcaatggatacacagacaatggggcttactggagatccctgtatgagacacccaccttt
gaggaagatctggagaggctgtacctgcagctgcagcccctgtacctcaacttgcatgcc
tacgtacgtcgtgccctgtacaacaaatatggagcagagcacataagcctgaagggtccc
attcctgctcacttgctgggcaacatgtgggcccagtcgtggtccaacatcttcgacctg
gtgatgcccttcccagatgccaccaaggtggatgccactccagctatgaaacaacagggc
tggacgcccaagatgatgtttgaggagtcggaccgcttctttacctccctgggcctcatc
cccatgccgcaggagttctgggacaagtccatgattgagaagccagcggatgggcgggag
gtggtgtgtcatgcctcagcctgggacttctacaaccgcaaggacttcaggatcaagcag
tgcaccgtggtgaacatggatgacctaatcacggtgcaccatgagatgggccacgtgcag
tacttcctgcagtacatggaccagcccatctcattccgcgatggagccaaccctggcttc
cacgaggccattggggatgtcatggccttgtctgtctccaccccaaaacacctgcacagc
atcaacctgctggaccaagtgacagaaaatgaagaaagtgacatcaactacctgatgagc
atcgccctggacaaaatcgccttcctgccctttggatacctcatggatcagtggcgctgg
aaggtgtttgatgggcggatcaaggaggacgaatacaaccagcagtggtggaacctcagg
ctgaagtaccagggtttgtgcccaccggtaccaaggtctgaagatgactttgacccagga
gcaaagtttcacatccctgccaacgtcccctacatcaggtactttgtcagcttcgtgatc
cagttccagttccaccaggcgctctgcaaagcagctgggcacacgggacccctgcacaca
tgtgacatctaccagtccaaggaggccgggaagctcctgggagatgccatgaagctgggt
ttcagcaagccatggcctgaagccatgcagctcatcacggggcagcccaacatgtcagca
gaggccctgatgagctactttgagcccctcatgacatggctggtgaagaagaacacagag
aacggggaggtgctgggctggcctgaatacagctggactccttacgcagtcaccgaattc
cacgctgccaccgacacagctgattttctgggcatgtctgtgggcaccaaacaagccacc
gcgggcgcctgggtcctgctcgcactggcacttgtcttcctgatcacctccatcttcttg
ggtgtcaagttgttctcatcaaggagaaaggccttcaaatccagctcagaaatggaactg
aaataa

DBGET integrated database retrieval system