KEGG   Gallus gallus (chicken): 419964Help
Entry
419964            CDS       T01006                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04210  Apoptosis
gga04625  C-type lectin receptor signaling pathway
gga04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    419964 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    419964 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    419964 (MAP3K14)
   04672 Intestinal immune network for IgA production
    419964 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    419964 (MAP3K14)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     419964 (MAP3K14)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: STE group
  Other
   419964 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 419964
NCBI-ProteinID: NP_001026098
CGNC: 434
Ensembl: ENSGALG00000000685
UniProt: Q5F350
LinkDB All DBs
Position
27
AA seq 909 aa AA seqDB search
MAVMGIACHGAPAPPAKQQQELSATKGLHEAASEKQSSVCKVEDSKKAIFHSQWKILNDV
ITKGTAKEETEGGCASISIIAQAECENSQEFSPTLSERSFIAHSKRYSRSDSLDQIPNNV
AHATEGRMSPTCWRGRHRGKARKKRHKKRSKLKIQTVAAGRRGPRTPEQESCTPIPVQED
ETHHSALYRNSFWLSELNKNLLYDPPPFQKPEKVLSTGKLHSAGSQHKTDLHKLISPVQC
LNHVWKLHYQRDNVPQPETVRPFPYNIMPPPFPHLDNPIHPMKLNALETYFHRDLNYPDS
EHRLSGLNLGYSFPKCVSQSVKSSLDKVSVEEYLVDALKGSVSLGEPQNLASLAKTWRGG
GLDLKEQFQKADENEGVLLTEKLKPVDYEYREEVHWTKCHGSLGIGSFGEVYKVEDKQTG
FQCAAKKVQVEHFRAEELTTCAAITSPKVVPLYGAVKEGPWVTIFMKLMEGGSLGQLIKQ
SGCLPEDRALSYLGQALEGLEYLHAQNILHGDVKAENVLLSDDGSRALLCDFGHSAHLHP
DGLGKCLVTGNYVPGTETHMAPEVVLGKRCDSKVDVWSSCCMMLHMLNGCHPWTQYYNHP
LCLKIAKEPPPLREIPPSCNPLTAEIIKMGLEKEPVQRASASELRTKASTALQEVGGVTS
PWRGEYREPRRLVLHQENNPQTSLPPAVSPASATPDPEPAARGCCAGPAPPPALERAQQR
EGTRWNASRELSRIWDPPPLSSTPLPLKSCSHTERATTISEQELQQLEIELFLNSLSQPY
SLEEQEQMLSCLSIDSPFVSDASEKNSMKASLSLRDTLSSGIHSWNSQTDGQSFSWNNVL
SRSRHTDTPSCFNGVKIQIQLLSGENLHIRDFHRTKVGDIATGISSQVRHRVGAIAVFHL
IHSFYPTAS
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatggggattgcgtgccatggagctcccgctccacccgccaagcagcagcag
gagctcagtgccaccaaagggctgcacgaggccgcgagcgagaagcaaagcagcgtttgc
aaagtcgaggattcaaagaaagccatcttccatagtcagtggaagatcctcaacgatgtc
atcaccaaaggaacagcaaaagaagaaacagaaggaggctgcgcgtccatctccattatt
gcccaagcagagtgtgagaacagtcaggagttcagccccactttgtcagagagatccttc
attgcccacagcaagcgttacagccgctcagacagcctcgatcagatcccaaacaatgtg
gcccatgcgacagaggggaggatgtctcccacctgctggagggggaggcatcgcggtaag
gcgaggaagaagcgtcacaagaaacgatccaagctgaaaatacaaacggtggctgctggc
agacggggccccagaactccagagcaggagagctgcactccgattcccgtccaggaggat
gaaacgcaccacagtgctctctacagaaacagcttttggttgtcagaactgaacaagaac
ttgctttatgatccacccccgtttcagaaacctgagaaagttctgtccacgggcaagctc
cattcagcgggcagccagcacaaaactgacctgcacaagctgataagccctgtccagtgc
cttaatcatgtctggaaactgcactaccagagggacaacgtccctcagcctgaaactgtc
cgtccttttccatacaacatcatgccccctcccttcccacatctggacaatcctatccat
cccatgaagcttaatgctctggagacatatttccatcgtgatctcaattacccagacagc
gagcatcgcttgtctggcctaaacctgggatacagcttccccaagtgcgtcagccagtct
gtgaaaagcagcttggacaaggtttctgtggaagaatacttggtggacgccttgaagggc
agcgtgagcctcggggagccgcagaacttagccagcctcgcgaagacgtggaggggaggc
ggtctggacctgaaggaacagtttcaaaaggcggatgagaatgaaggcgtgctgctcact
gagaaactaaagccagtggattatgagtaccgagaagaggttcactggaccaagtgccac
ggctctctgggcatcggctcttttggagaagtatacaaagtggaggacaagcagacagga
tttcagtgcgctgccaaaaaggtgcaggtcgaacacttccgtgcagaggagttaacgacg
tgcgcagcgataacgagccctaaagttgtgcctttgtacggtgccgtgaaggagggacct
tgggtgaccatcttcatgaagctgatggagggtggatcactgggtcagctaattaagcag
agcggctgcctgcccgaggacagagccctcagttacctggggcaggcgctggaaggtctg
gagtacctccatgctcagaacattctccatggagatgtgaaagcggaaaatgtgcttttg
tctgatgatgggagcagagctctgctgtgtgatttcggtcactctgctcatctccatcct
gatggcttggggaagtgcttggtcacagggaactatgtgcccggcacggagacacacatg
gctccagaggtggtcctggggaagcgctgcgactccaaggtggacgtgtggagcagctgc
tgcatgatgctgcacatgctgaacgggtgccacccctggacgcagtattacaaccatccc
ctctgtctgaagatcgcgaaggagccgcctcctctgagggaaattccaccttcctgcaac
cccctcactgctgagatcattaaaatgggtctggagaaggagcccgtgcagagggcgtct
gcgtctgagctgaggaccaaggccagcactgcgctgcaagaagtgggaggtgtgacaagc
ccctggagaggcgaatacagagagcccaggcgtttggtgttgcaccaagagaacaacccg
cagacatccctgccccccgcagtgagcccagcttcggccactcctgacccagaaccggca
gcacgaggctgctgtgccggccctgcgccaccgccggccctggagagagcgcagcagcgc
gagggaacccgctggaatgcgagcagggagctgtccaggatctgggatcctcctcctctc
tcctccactcccctccccttaaagagctgcagccatacggagagagcaaccaccatttct
gaacaagagctccagcagctggaaatagagctgtttctgaacagcctttctcagccatac
tcactggaagagcaggaacaaatgctttcgtgtctcagcattgacagcccatttgtgtca
gatgccagtgagaagaactccatgaaggcttccctcagcctgcgggacaccctgagctcc
ggcatccattcctggaacagccagacagacggacagagcttcagttggaacaatgtgctg
agccgcagccgccacacggacacccccagctgcttcaatggagtgaaaatccagatccag
ttgctaagcggagaaaatttacatatcagggatttccacaggacaaaggtgggagacatt
gccactgggataagcagccaggtgaggcacagggttggagctatcgcagtctttcattta
atccattccttctatcctaccgcctcctaa

DBGET integrated database retrieval system