KEGG   Gallus gallus (chicken): 420404Help
Entry
420404            CDS       T01006                                 

Gene name
SETD2
Definition
(RefSeq) histone-lysine N-methyltransferase SETD2 isoform X2
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    420404 (SETD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    420404 (SETD2)
Enzymes [BR:gga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     420404 (SETD2)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     420404 (SETD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET AWS WW
Motif
Other DBs
NCBI-GeneID: 420404
NCBI-ProteinID: XP_015136611
CGNC: 4103
Ensembl: ENSGALG00000042051
LinkDB All DBs
Position
2
AA seq 2559 aa AA seqDB search
MGDFYDPEHPTPEEEENESKTETVQKAGFIKGPVFKGVASSRFLPKGTKTKVNLEEQGRQ
KVSFSFSLTKKTLPNRFLPGLGNEKQNETQNSPAVSLQTDFNPKIKMDLGDAAGSTEESS
PPKPKVELGKIHFKKHLLSVTTKPPPPAAAATLLPPPPALAPVTEPVAAAADFPSAPPPP
PTASPAAPMPVPTAAALPQLPVTLMSTLLLSPPVQAEVPASKEPCHVVPKEALELDPKQD
VVSHGLEEHLTQHVAEQVEVTPQKEDSHIGKDDEVSDSSKGASLCSRKQSSKRKFSQSDG
TLLGSESDEDSVRTSSSQRSHEQKISSAEKERDPRKSSSSLRGEELKSSSRSRSDRDEKY
SSYSKSERDSRYSSSRSRSDRERRRSRSHSRSRSDRSSRTSSSYSRSERSHYYESDRRYH
RSSPYRERTRYSRSYADSRGRESSDSEDEYRRTHSRSSDSRRTSSHSSYRESRTSYSKSD
RDSKVESSHADVERRGKSSKADRDSKRTSESEVTKRCSPLNELGYRKGTSHSKPDSNVNS
SRYKSTPSKIPAPKPDKFKSSFCCTESVEEIKQQSNSLDLETSCLKSNEIRVSIAKRFER
EKTLSPLNQLNDSPTFKKTDESKAAFPHSGSEELASNECHDSVKEQETLVRVKHEQLRTG
FPIEMNINGSPEGSSDDLAAPSASKAEDVAVSSDDSLCRLEASHVGRTSNSYPLPSNGFE
STYTPKEHEPDDSHVQSSECSSLFKEEEALVLEQQSEAMPLPVVNVDDSKISVNNLDDQA
APCDKTKEPVFCYVSDDATPSLYHSEVEIEVEPADVKVTSEPFLDLHVEPQTVTCDYEST
EDPNSKSACEVEQYHVNPPHQAGLAVDSSSRDSAQDCSSPRIRQDCPLVTQHLEENVPSE
GGGALPSCSGTGEVLELDVRHVDLNSAQGKLSLKDEHSYYSQVPLEHCSREEAAEEMAVT
TERVGPDDLKEQDQGASAEDDGGNEPLVASAFPDASFPSCDVVVAAEEPEAVTQAPTCDS
SGGTSEFAPAPHDDYSDTAESDSEPGSDDSDTEDTDSDDGVPRKRLQSVVVVPKNSSIAM
EDSSPCSSRSSQGARRYSDHWDDERPEPSRPYYEERPEATASNNGLQAESRCSPRGMEKS
PASSTELSRKDGEELRADACQPQSDGVDSTSQTDLAVDSQGKPNTDERMLNELMSIGRPL
GRQEEQPFCVPESFESTNESCHQMSFSKPDSWQGSGGLHQSGLGDCSREDGFHSVEGMGG
VSWELQAEKPSSTYQQPDSSFGVYSGYVYQPGTGAYSSSQNCWQGNGYWDARSAGRPAGG
NYERVQGQVPDSLTEDHEEYEDDRWDDECKAGFPSPSSKFHAPGQKETGSVQAHEISSNS
SKEPVSGTEKKEEVKALEKNDVKERGPPKKRRQELESDSESDADSRERKKVKVEGEQEVA
PQDSSMVGRPCIMDDFRDPQRWKEFAKQGKMPCYFDLIEENVYLTERKKSKSHRDIKRML
CECPPLSKEERAQGEVACGEDCLNRLLMIECSSRCPNGDYCSNRRFQKKQHADVEVILTE
KKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDAT
QKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKC
FCGSANCRGYLGGENRVSIRAAGGKMKKERSRKKDSVDGELEALLENGEGLSDKNQVLSL
SRLMVRIETLEQKLTCLKLIQNTHSQSCLKSFLECHGLSLLWIWMTELGDSRGSTANNLK
LQLEIMKTLELLPIPTKNMLEESKVLPIIQRWAQTKSAIPQLSEGDGYSSENTSRAHTPL
NTPELSAKQSAEGDTDTPKKLVFRRLKIISENSMDSAISDTTSELEGKEGKEDLDQLEVA
PTEVSEEQQPQQEVKVAVDTPVESSKPQELEAEPEVEVKESNGTKLEEPITMETPSQDEE
EGVSDVESERSQEQTDKIVDVSDLAIRLLDCWKDLKEVYRIPKKSQAEKESSADRGREAA
GLRDQTPTPKNPVLSRTDPEWQNLSKEKKRRRDSLSPPASAYERGTKRPEDRYDTPASKK
KVRLKDRNKLSTEERRKLFEQEVAQREAQKQQQQLQNLGITSPLPYDSMGYGTPHHSFIG
YPPGYPMQAYVDPSNPNAGKVLLPTPSMDSMCSPAAYEHPQPMVGHTVEPTLPTPQPVPV
VQHVATPMEVTTPQYVAQSDAVVHQEPNVAVLPVPTTGPVQGQSYGVWDSSQQTVAVQQQ
YSPAQSQPAIYYQGQTCQTVYGVTSPYSQTTPPIVQSYTQPGLQYIQGQQIYTAHPQGVI
VQPPPAVTTIVAAGQPQPIQQPELVVTNNLLDLPPPSPPKPKTIVLPPNWKTARDPEGKI
YYYHVVTRQTQWDPPTWDSPGDDASLEHEAEMDLGTPTYDENPMKSSKKPKTAEADTSSE
LAKKSKEVFRKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCK
NPEDLECNENVKHKTKEYIKKYMQKFGAIYKPKEDTDLE
NT seq 7680 nt NT seq  +upstreamnt  +downstreamnt
atgggggacttctacgacccggagcaccccaccccggaagaagaagaaaatgagagcaag
actgaaaccgtgcagaaagctggctttatcaaaggcccagtgttcaaaggtgttgcttct
agtcgctttttgcccaaaggcaccaaaacgaaggttaaccttgaggagcaaggaagacaa
aaggtgtctttcagctttagcttaaccaagaaaaccttaccgaacagatttctgcccggt
ctgggaaacgagaaacaaaatgaaactcagaactccccagcagtatccctacagactgat
tttaaccccaaaattaaaatggaccttggggatgctgctggttcaacggaggagtcttca
cctccaaaaccgaaggtagaactggggaaaatccattttaagaaacatttacttagtgtc
acaaccaaaccccccccaccagctgcagcagcaactttactgccgccgccaccggctctg
gcaccggtaacagaaccagtggcagcggctgcggactttccatcggcaccaccacctcca
ccaacagcatcaccagcagcaccaatgcctgtccccactgcagcagccttgccacagctg
cctgtcacgctcatgtcaacgctgttgctgtcaccgcctgtacaagcagaagtcccagct
tcgaaggagccgtgtcacgtagtcccgaaggaggctctggagctggaccctaagcaggat
gtggtatcgcacggtttggaagagcatctaactcaacacgtggccgagcaggtggaagta
actccacagaaggaagattcccatattgggaaagatgatgaggtttcggacagctccaag
ggtgcttctttgtgctctaggaaacagagctccaaaaggaagttctcccagtctgatggc
acgttgctgggctccgagtctgatgaagattctgtgaggacttcttctagccagcgctca
catgagcagaagatatccagtgcagaaaaggagagggatcccaggaaaagctcttcctct
ctcagaggagaagaactgaagtcctcctcgcgctccagatcggacagagatgagaagtat
tctagctattcgaagtcagaacgagattcgcggtattcatcttcccgatccaggtctgac
agagagagaaggcgaagccggtcccattctcggtcccggtcggatcggagctcccgaacc
agctcttcctactcgaggtcggagcgctcacattactatgaatctgaccgcaggtatcac
cggagctccccgtacagagagaggacaagatactcccgctcgtacgcggactccaggggg
agggagagctctgattcggaagacgagtacaggaggacgcattccagatccagtgactcg
aggcgcacgtcgtcccactcctcgtacagggagtcaaggacttcttactctaaatcagac
agggacagcaaagtagagtcatctcatgctgacgtggagaggagaggaaagtcttcaaaa
gcagatagagattcaaaacggacttcagaaagtgaagtaaccaaaaggtgctctcccctt
aacgagctcgggtatcgaaaggggacttcccattctaagcctgacagtaatgtgaattct
tcccgttataagtccaccccttcaaagatccctgcaccaaagcctgataaatttaaaagt
tctttctgttgtacagaatcagttgaagaaataaaacagcagtctaattctctagattta
gagacctcttgtttaaaaagcaatgagatcagagtgtccattgcaaaaagatttgaaagg
gaaaagacactttctccattaaatcagttaaatgattcccccacttttaaaaagacagat
gaatcaaaagctgcttttcctcactcagggtctgaggaacttgcaagcaatgaatgccat
gacagtgttaaggagcaagagactttagtaagggtaaagcacgagcaattgagaacaggt
ttccctatagaaatgaatataaatgggtccccagagggtagctctgacgatctggcagct
cccagtgcctccaaagcagaggatgttgcagtgtcttctgatgatagcttgtgtaggttg
gaagcatcacacgttggaaggacgagtaactcgtatccgttgccgtcgaatggatttgag
agcacatacacccctaaagagcacgagcctgacgattctcacgtacagtccagtgagtgt
agcagcctgttcaaggaggaagaggctttggtcctggagcagcaaagtgaagctatgcct
ttgccagttgtgaatgtagatgattccaaaatttcagtgaacaatctggatgatcaggca
gctccctgtgacaaaaccaaagaaccagtcttttgctacgtttcagatgatgccacccct
tctttgtatcattcagaagttgaaattgaagttgaaccagcagatgtaaaagtgacttcc
gagccgtttctggacttgcatgttgaaccacagacggtgacgtgcgactatgaaagcaca
gaggatccgaattcaaagtctgcttgtgaagtggagcagtatcacgttaacccaccccat
caagcaggcctggctgtggatagttcaagcagggattctgcccaggactgctcttccccc
agaatcaggcaagactgtcctttggttacgcagcatctggaggagaacgtcccctccgag
gggggtggggccctgccgagctgctcgggcactggagaggtgctcgagttggatgttcgg
cacgttgacctgaactcagcacagggcaagctgtcgctcaaggatgagcattcctattat
tcccaagtgccactggaacactgcagcagagaggaggcagcggaagaaatggccgttact
acggagagagttggtcctgatgacctgaaggagcaagaccagggagcatctgccgaggat
gacggggggaatgagcccttggtggcttcagcttttccagacgcttcatttccatcttgt
gatgttgtggtggctgcagaagagccagaagccgtaacgcaagccccaacgtgtgacagc
agtggtggtacctccgaattcgctcccgctccccacgatgactattccgacacggctgaa
agcgacagcgagccgggcagcgatgacagcgacacagaggatactgattctgatgatgga
gtgccgcggaaacggctgcagtccgttgtggttgtcccaaagaactcgagcattgcgatg
gaggacagcagcccctgctcctcgcggagcagccagggtgcgcggcgctactccgaccac
tgggatgatgagaggccggaaccaagcaggccctactatgaggagaggccagaggctacg
gcgagtaacaacgggctccaggctgagagcaggtgctctccaagagggatggagaagagt
ccggcctcgtctactgagctcagcaggaaggatggggaagagctgcgggcagacgcctgc
cagccgcagagtgatggtgtggacagcacaagccagacagacctggctgtggattctcaa
ggcaaacccaatacagatgagagaatgcttaatgagctgatgtccattggtaggccgctt
ggccggcaggaggagcagccattttgtgtgcctgagagctttgagagcaccaatgagtct
tgccatcagatgagcttttccaagccagacagctggcagggcagtgggggtctccatcag
tctggccttggagactgctccagggaggatggttttcattcagtagagggtatgggtggc
gtgagctgggagttgcaggcagagaagcccagcagcacctatcagcagccagatagcagc
ttcggggtctactcaggctacgtttaccagccaggcacaggagcctacagcagctctcag
aactgctggcagggcaatggctactgggatgcgaggtctgctgggcggcctgctggaggc
aactatgaacgagttcaaggacaagtgccggattctctaacggaggatcacgaggagtac
gaggatgaccgctgggatgatgagtgcaaggctggcttccccagcccctccagtaagttc
cacgctcctgggcagaaagagacaggctccgtgcaagcccatgagatcagcagcaactcg
agcaaggagccggtgtctggtactgagaaaaaggaggaggtgaaggctttggaaaagaac
gatgtgaaagagcgaggccctcccaaaaaacgacggcaggagctggagagtgactccgag
agcgatgcggactcaagggagaggaagaaggtgaaggtggagggtgagcaggaggtggca
ccgcaggactcctccatggtcggccgcccgtgcatcatggacgacttccgcgacccgcag
cgctggaaggagtttgccaagcaggggaaaatgccctgttacttcgacctcattgaggaa
aatgtgtacttgacagaaaggaagaagagcaaatcccaccgggatattaagaggatgctg
tgtgaatgccctcctctctccaaggaagagcgagcacagggggaggttgcttgtggagag
gactgcctgaaccgcctgctcatgatcgagtgttcttccaggtgcccaaatggtgactac
tgttccaaccggcgcttccagaagaagcagcatgcagatgttgaagtaatcctcactgag
aagaaaggttgggggctcagagctgccaaagatctcccatcaaacacttttgtgttggag
tactgcggagaggtgctggaccacaaagagttcaaggcacgtgtgaaggaatatgcccgc
aacaagaacatccactactacttcatggctttgaagaatgacgagataatagatgctacc
cagaaaggaaactgttctcgttttatgaaccacagctgcgaaccaaactgtgagacacaa
aagtggactgtgaatgggcagctcagagttgggttcttcaccaccaagctggtcccgtcg
ggctccgagctgacctttgattaccagttccagagatacggcaaagaagctcagaaatgt
ttctgtggctcagccaactgcagaggctacctgggaggagagaacagggtcagcatccgg
gctgcaggggggaagatgaagaaggaacgctcccgtaagaaggattcggtggacggggag
ctggaggcactgctggagaatggggagggcctctcagacaagaaccaagttctcagcttg
tcccggctgatggtgcgcatcgagaccctggagcagaagctcacctgcctcaagctcatc
cagaacacgcactcacagtcctgcctgaagtccttcctggagtgccacggcttgtcactg
ctgtggatctggatgacagagctgggtgacagcaggggaagcaccgccaacaacctcaag
ctgcagctggagattatgaagacactggagctgctgccgatacccaccaagaacatgctg
gaggagagcaaggtgcttcccatcatccagcgctgggctcagaccaagagtgccatccca
cagctcagtgaaggcgatgggtactcgagtgagaacacgtcgcgcgctcacacaccgctc
aacacgccggagctgtctgccaagcagagtgctgaaggagacacagatacccccaagaaa
ctggtgttccggaggctcaaaattataagtgagaacagcatggacagtgccatctcggat
acaactagtgagctggaggggaaggaaggcaaagaggacctggaccagctggaggttgcc
ccgacggaggtgtcagaggagcagcagccgcagcaggaggtgaaagtggccgtggacaca
ccggtggagagcagcaagccccaggagctggaggctgagcctgaagtagaggtcaaggag
agcaatggcaccaagctggaggagcccatcacgatggaaacgccgtctcaggatgaagag
gaaggcgtatctgacgtcgagagcgagaggagccaagagcaaacggacaaaattgtggat
gtgagcgacttggccatcaggctgctcgactgctggaaagacctgaaggaggtgtaccga
atcccaaagaagagtcaagcagaaaaggagagcagtgctgaccggggcagagaggcagct
ggcctcagggatcagactcccacaccgaagaaccccgtcctgagccgcacagaccccgag
tggcagaacctgagcaaggagaagaagaggaggcgagactcgctgtcccctccagcatca
gcgtatgagcggggcaccaagaggcccgaggacaggtatgacacaccagcatcaaagaag
aaagtccgcctcaaggaccgcaacaagctgtcgacagaggagcgcaggaagctctttgag
caggaggtggcccaacgggaggcccaaaagcagcaacaacaactgcagaacttgggcata
acgtccccccttccctacgactccatgggctatggcacaccgcaccacagcttcatcggc
tacccgcccggctaccccatgcaggcctacgtggaccccagcaaccccaacgcgggcaag
gtgctgctgcccaccccaagcatggactctatgtgctccccagcagcatacgagcaccct
cagcccatggtggggcacacggttgaacccaccctgcccactccccagccggtcccagta
gtccaacatgtagcaacgccgatggaggtgacgactcctcagtatgtagcacaaagcgac
gccgtggtccaccaagaacccaacgtggctgtcctgcccgtgcccaccacaggaccagtg
caggggcagagctatggggtgtgggattccagccagcagacggtggccgtgcagcagcag
tactcgccagcccagtcccagcctgccatatattaccagggccagacctgtcagactgtt
tatggggtgacgtccccctactcgcagacgaccccaccgattgtacagagctacacccag
ccaggcctgcagtacatccaggggcagcagatctacacggcccacccgcagggagtgatc
gtccagcccccgcctgccgtcaccaccatcgtggcagctgggcagccacagcccatccag
cagccagagcttgtggtgaccaacaacctcctggacctgcctccgccatcccctcccaaa
cccaaaaccattgtcctgcctcccaactggaaaacagcccgagaccccgaggggaagatc
tactactaccacgtggtaacgaggcaaacccagtgggaccctccaacgtgggacagccca
ggggatgatgccagcctggagcacgaagctgagatggatcttgggaccccaacgtatgat
gaaaacccaatgaagtcttccaaaaagcccaagactgcagaagcagacacgtcgagcgag
cttgccaagaagagcaaggaagtcttcaggaaagagatgtcccagttcatcgtgcagtgc
ctcaacccctatcgcaaacccgactgcaaggtgggccgcatcaccaccactgaggacttc
aagcacctggcacgcaagctgacgcacggcgtcatgaacaaggagctcaagtactgcaag
aacccggaggacctggagtgcaacgagaatgtgaaacacaaaacgaaggagtacataaag
aaatacatgcagaaattcggggccatctacaaacccaaagaggacacggacttggagtga

DBGET integrated database retrieval system