KEGG   Gallus gallus (chicken): 422013
Entry
422013            CDS       T01006                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00230  Purine metabolism
gga01100  Metabolic pathways
gga04020  Calcium signaling pathway
gga04114  Oocyte meiosis
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
gga04371  Apelin signaling pathway
gga04540  Gap junction
gga04912  GnRH signaling pathway
gga04914  Progesterone-mediated oocyte maturation
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    422013 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    422013 (ADCY3)
   04020 Calcium signaling pathway
    422013 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    422013 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    422013 (ADCY3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    422013 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    422013 (ADCY3)
   04916 Melanogenesis
    422013 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    422013 (ADCY3)
   04270 Vascular smooth muscle contraction
    422013 (ADCY3)
Enzymes [BR:gga01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     422013 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA DUF1673
Other DBs
NCBI-GeneID: 422013
NCBI-ProteinID: XP_015140678
CGNC: 12445
Ensembl: ENSGALG00000016608
LinkDB
Position
3
AA seq 1128 aa
MPRNRDFSEPEYSAEYSADYSVSLPSDPEHAVGRTHEVTVRSSGPCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDCYVLLTCAAVYAADKLAPALAAGTGLAAHVL
LFALCKYRLLPERAARRFLPYVLWVLILAQIFCYLGLNFSRSPEASDTVGWQAFFVFSFF
ITLPLRLAPIVLITAVSCGVHTLVLGVTVAQQRQDALDEGTLLRQILSNIAIYLCAITVG
TMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLMLSILPKHVADEMLKDMKKDPS
QKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSIMMGLAMVEAISYVREKTKTAVDMRVGVHSGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFEVEPGEGGSRCE
YLKEKGIVTYLIVVPKQPLRNGINGVKLSLTSSHGGSPLLVNTKERNGSVSLACTSPEEP
DEPNARVRGTKENGEEDGEAVNPSFPNPRRRLRLRDLAERVIDASQNEQELNKLLNEALL
ERESVQALKGKSTFRLSMRFIDPEMETRYSVEKEKQSGAAFSCSCVVLFFTALVEVFIDP
WLVANYVTFVVGEILLLILTLCSLAAIFPRVFPKKLVAFSTWIDRTRWARNTWAMAAIII
VTMADIVDMLSCQQDYSGTGNGTVVPPRPGGCWEQPKYYSYIAVLALVATIMLVQVSHMV
KLTLMVLITGAAGTVNIYAWEHIFDQYDRRRSQQSIRSSLVPSKYSMTAMIFIVMLSFYY
FSRHVEKLARTLFLWKIDVHDQKERVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELY
SQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFDALLDEPQFRCITKIK
TIGSTYMAASGVTPDANANGYSTKKETLSDKERWQHLADLADFALAMKVTLMNINYQSFN
NFMLRIGMNKGAVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETHLILKEY
GFRFVRRGAIYVKGKGELLTFFLKGREKQGSFVNGSSVTLPHQVVDSS
NT seq 3387 nt   +upstreamnt  +downstreamnt
atgccgaggaacagggatttctcggagcccgagtactcggccgagtactccgccgactac
tcggtgagcctgccgtcggaccccgagcacgccgtgggccggacccacgaggtgacggtg
cgcagctcggggccgtgcctctgcctgccccgcttcatgcgcctcaccttcgctcccgag
tccctggagaacctctaccagacctacttccgtcgccagcgccacgagaccctcctggtg
ctggtggtcttcgccgccctcttcgattgctacgtcctcctcacgtgcgccgcggtctac
gccgccgacaagttggccccggcgttggcagcggggactgggttggccgcccacgtgttg
ctcttcgccctctgcaaataccggctgctccccgagcgcgccgcccgccgcttcctgccc
tacgtcctctgggtcctcatcttggcccagatcttctgctacttgggcctcaacttctcg
cgctcgcccgaggccagcgacacggtgggctggcaggccttcttcgtcttctccttcttc
atcacgttgccgctgcgcctggcgcccatcgtgctcatcaccgccgtgtcctgcggcgtc
cacacgctggtgctcggcgtcactgtcgcccagcagaggcaggatgccctggatgagggc
acgctgctgagacagatcctgtccaacattgccatctacctttgtgccatcacggtgggc
accatgtcctactacatggctgaccgcaagcaccgcaaggccttcctggaagcgcggcag
tccctcgaggtcaagctcaacctggaggagcagagccagcagcaggagcggctgatgctc
tccatcctgcccaagcatgtggcggatgagatgctgaaggatatgaagaaggacccgagc
cagaaggagatgcagcagttcaacaccatgtacatgtaccgccatgagaatgtcagcatc
ctctttgcagacatcgtgggcttcacgcagctctcctcgtcctgcagcgcccaggagctg
gtgaagctcctcaacgagctcttcgcccgcttcgacaagctggcagctaaataccaccag
ctgcgcatcaagatcctgggtgactgctattactgcatctgtgggctgcccgactaccgg
gaggaccacgccgtctgctccatcatgatggggcttgccatggtggaggctatttcttac
gtgagggaaaagaccaagacagcggtggatatgcgtgtaggagtgcacagtgggacggtg
ctgggcggcgtgctgggccagaagcgttggcagtacgacgtgtggtccaccgacgtcacc
gtggccaacaagatggaggcaggtggcatccctgggcgcgtgcacatctcgcagagcacc
atggattgcttgaagggcgaatttgaggtggagccaggcgagggtggctctcgctgcgag
tacctgaaggagaaaggcattgtcacctacctcatcgtggtgcccaagcagcctctacgc
aatggcatcaatggggtgaagctgtcactgacctcatcccatggaggctccccactgctc
gtcaacaccaaggagcgcaatggcagcgtcagcttggcgtgcaccagccctgaggagcct
gatgagcccaatgccagagtgaggggcaccaaggagaacggggaggaggatggagaggcg
gtgaacccatccttccccaacccgcggcgccggctgcggctacgggacctggctgagcgg
gtaatcgatgcatcacagaatgagcaggagctcaacaagctgctcaacgaggccctgctg
gagcgcgagtctgtccaggcgttgaaggggaagagcaccttccggctctccatgcgcttc
attgaccctgagatggagacacgctactcagtggagaaggagaagcagagcggtgctgcc
ttcagttgctcctgtgttgtcctcttcttcactgccttggtggaggtcttcattgaccct
tggttggtggccaactacgtgaccttcgtggtgggggagatcctgctgctcatcctcacc
ctctgctcactggctgccatctttccccgggtcttccccaaaaagctcgtggccttctcc
acttggattgacaggactcgctgggcacgcaacacctgggccatggctgccatcatcatt
gtcaccatggctgatattgtggacatgctcagctgccagcaggactacagtgggacaggc
aatgggacggtggtgccaccacggccaggcggctgttgggagcagcccaagtactacagc
tacatcgccgtgctggccctggtggccaccatcatgctggtgcaggtcagccacatggtc
aagctgactctcatggtgctgatcactggggcagctggcactgtcaacatctatgcctgg
gagcacatcttcgaccagtacgaccgccgccgcagccagcagagcatcaggtcctcactg
gtcccctccaagtactccatgacagccatgatcttcatcgtgatgctcagcttttactac
ttctctcgccacgtggaaaagctggccaggacgctcttcctctggaagattgatgtccat
gaccagaaggagcgggtctatgagatgcggcgctggaacgaagcccttgtcaccaacatg
ctgcccgagcatgtggccaggcacttcctgggctccaagaagagggatgaggagctgtac
agccagtcctatgatgagattggcgtcatgtttgcttctctccccaacttcgccgacttc
tacacagaggagagtatcaacaatgggggcatcgagtgcctgcggttcctcaacgagatc
atctctgactttgacgcactcctggatgaaccccagttccgctgtatcaccaaaatcaaa
accatcggcagcacctacatggccgcgtctggagtgacccccgatgccaatgccaatggc
tacagcaccaagaaggagaccctctcggataaggagcgctggcagcatttggctgacctc
gctgactttgccttggccatgaaggtgacgctgatgaacatcaactaccagtccttcaac
aacttcatgctgcgcataggcatgaacaagggtgccgtgctggcaggagtcattggtgcc
cgcaaaccacactatgacatctggggcaacacagtgaacgtggccagcaggatggagtcc
actggtgtgatggggaacatacaggtggtagaggagacacacctcatcctgaaggagtac
ggcttccgcttcgtgcgccgtggggccatctacgtcaagggcaaaggggagctgctcact
ttcttcctcaagggccgggagaagcagggctccttcgtcaatggctcatctgtcaccctg
ccccatcaggtggtggacagctcctga

DBGET integrated database retrieval system