KEGG   Gallus gallus (chicken): 422082Help
Entry
422082            CDS       T01006                                 

Gene name
GAA
Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00052  Galactose metabolism
gga00500  Starch and sucrose metabolism
gga01100  Metabolic pathways
gga04142  Lysosome
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    422082 (GAA)
   00500 Starch and sucrose metabolism
    422082 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    422082 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    422082 (GAA)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     422082 (GAA)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   422082 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 422082
NCBI-ProteinID: XP_015151087
CGNC: 51619
Ensembl: ENSGALG00000038853
LinkDB All DBs
Position
18
AA seq 970 aa AA seqDB search
MQILIKDVLSQSAFCLFCFIRFTSFIFPHGFVASALSGGAQPHRSGGRAVRSGAELRCPG
GSRRRRRAQREGRAEPGRSGAGAGAMAVAMAMAMAALRAVLLALLLRSLPSAGSSADSAC
AVPPDDRFDCGPERLLARAGCEARGCCYVPAGPGDGGGPPWCFFPRGYRSYRADNVTATA
GGYAARLRRVVPSFLPADVGTLRLDVALETESRLRFTLRDPARQRYEVPVATPRVSIRAA
DLLYGVRLRQDPFGIVVFRQPGGQVLLNTSVAPLFFADQFLQISTSLPSRFISGLGERLT
PLILDTAWTKVTLWNRDMAPVPQVNLYGSHPFYLVLEDGGSAHGVFLLNSNAMDVLLQPS
PALTWRTTGGILDFYVFLGPDPQSVVRQYLDVVGFPFMPPYWALGFHLCRWGYSSTAATR
QAAANMSAGRFPLDVQWNDLDYMDAKRDFTYNKETFRDYPDMVHDFHQRGLHYVMIVDPG
ISSSGPPGTYRPYDDGLKRGVFIRNATGQPLIGKVWPGPTAFPDFTNPETHEWWHDMVRD
FHEQVPFDGMWIDMNEPSNFVEGSQDGCPDNSLEKPPYVPGVFGGRLQAGTICASSQQHL
SSHYNLHSLYGLTEAIASHNALLRVRGTRPFVISRSTFAGHGRYAGHWTGDVESSWEQLA
RSVPEVLLFNLLGVPLVGADICGFVGDTSEELCVRWTQLGAFYPFMRNHNDHGNRPQEPY
AFSLAAQDAMRRALRLRYSLLPHLYTLFHRAHVDGDTVARPLFLEFPKDPNTWSVDRQLL
WGAGLLITPVLEQGQTKVSGYFPAGTWYSFTGDSTIHSRGQWILLAAPLDTINVHIRAGH
ILPLQEPGLNTAESRKKGMTVVVALTPDGFARGELYWDDGESWQSFEKGDCTEILFLAAR
GAVLSQILRAGGHLDGILLEAVTVLGVPSAPQRVLANGVPVEDFSYRSDTQVLRVSVLLP
MWEQFVVSWS
NT seq 2913 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatcctcattaaagacgtgctatcgcaaagcgcgttttgtttattttgcttcatc
cgtttcacgtcctttattttcccacacgggttcgtcgcttccgcgctttcaggcggcgct
cagccgcatcgctccgggggccgcgcggtgcggagcggcgcggagctgcggtgccccggt
gggagcaggaggcggcgccgcgcacagcgggaagggagagcggagcccggaaggagcggg
gccggggccggggctatggctgtggctatggctatggctatggcggcgctgcgggcggtg
ctgctggcgctgctgctccgctcgctcccctccgccggcagctccgcggactccgcctgc
gcggtgcccccggacgaccgcttcgactgcggccccgagcggctgctggcgcgggcgggc
tgcgaggctcggggctgctgctacgttccggccggccccggcgacggcggcggccctccc
tggtgcttcttcccccgcggctaccgcagctaccgggcggacaacgtgacggccacggcc
ggcggctacgcggcccggctccgccgcgtggtgcccagcttcctgcccgcggacgtgggc
acgctgcggctggacgtggcgctggagaccgagagccgcctgcgcttcacgctccgcgat
ccggcgcggcagcgctacgaggtgcccgtggccacaccgcgggtgagcatccgcgcggcc
gacctcctgtatggggtgcggctccgccaggacccgttcggcatcgtcgtgttccggcag
cccggcgggcaggtcctgctcaacaccagcgtcgctccgctgttctttgcggaccagttc
ctgcagatctccacctctctgccctcccgtttcatttctgggctgggggagcgcctgacc
cctctcatcctcgacacggcctggaccaaagtcacgctgtggaaccgggacatggcaccc
gtgccccaggtcaacctctatggctcccaccccttctacctggtgctggaggatggtggc
tctgcgcatggcgtcttcctgctgaacagcaatgccatggacgtgctcctgcagcccagc
ccagccctgacctggcgcacgacgggcggcatcctggacttctatgtcttcctgggccct
gacccccagagcgtggtgcggcagtacctggatgtcgttgggttccccttcatgccccca
tattgggccctgggcttccacctgtgccgctggggttactcctccaccgccgccacccgg
caggctgcagccaacatgtcagctgggcgcttccccctggacgtgcagtggaacgacctg
gactacatggatgccaagagggacttcacctacaacaaggaaaccttcagggattacccc
gacatggtgcacgacttccatcagcgtggcctgcactacgtcatgatcgtggatcctggc
atcagcagctcagggccgcctggcacctaccggccctacgacgatgggctgaagcgagga
gtgttcatccgcaacgccacggggcagccgctcatcgggaaggtgtggccgggccccacg
gctttcccagacttcaccaatcctgagacgcacgagtggtggcacgacatggtgagggac
ttccacgagcaggtgcccttcgacggcatgtggattgacatgaatgagccgtccaacttt
gtggagggctcccaggacggctgccccgacaacagcctggagaagcccccatacgtgcca
ggtgtgttcgggggccgcctgcaggcgggcaccatctgtgcctccagccagcagcacctg
tcctcccattacaacctgcacagcctgtacgggctgaccgaggccatcgcctcccacaat
gcgctgctcagggtgcggggcacgcggcccttcgtcatctcgcgctccacgtttgcggga
cacggccgttacgcagggcactggacaggggatgtggagagcagctgggagcagctggcc
cgctccgtgccagaggtgctgctcttcaacctcctcggggttccgctggtgggcgctgac
atctgtggctttgtgggtgacacatccgaggagctgtgcgtgcgctggacccagctggga
gccttctaccccttcatgaggaaccacaacgaccacgggaaccggccacaggagccctac
gccttcagcctggccgcgcaggatgccatgaggagggccctccgcctccgctactccctc
ctgccccacctttacaccctcttccaccgggcacacgtggatggggacacggtggcacgg
ccgctgttcctcgagttccccaaagaccccaacacgtggagcgtggaccgccagctgctg
tggggcgcagggctgctgatcacaccggtgctggagcagggacagaccaaagtcagcggc
tatttcccagctgggacgtggtacagcttcacaggggactcgaccatccacagcagaggg
cagtggatcctcttagcagctcccctggacaccattaacgtgcacatccgagcagggcac
atcctgcccctgcaggagcccggactgaacacggctgagtcccgcaagaaggggatgact
gtggtggtggccctgacgccggacggcttcgcccgtggagagctgtactgggacgatggg
gagagctggcagagctttgagaagggggactgcactgagatcctcttcctggctgcacgt
ggcgccgtgctcagccagatcttgcgggcgggcggccacctggatgggatcctgctggag
gctgtcaccgtgctgggtgtccccagtgctccacagcgagtcctggccaacggcgtcccc
gtggaggacttctcgtaccgcagtgacacccaggtgctgcgtgtctccgtgttgctgcca
atgtgggagcagtttgtggtctcttggtcctga

DBGET integrated database retrieval system