KEGG   Gallus gallus (chicken): 422810Help
Entry
422810            CDS       T01006                                 

Gene name
SOD3
Definition
(RefSeq) extracellular superoxide dismutase [Cu-Zn]
  KO
K16627  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    422810 (SOD3)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     422810 (SOD3)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate/Haparin
  Enzymes
   422810 (SOD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 422810
NCBI-ProteinID: XP_015141186
CGNC: 13599
Ensembl: ENSGALG00000018557
UniProt: F1NHI4
LinkDB All DBs
Position
4
AA seq 378 aa AA seqDB search
MQHDVCQPASGKRPLWAPTDVCRLTTAWETGRKQLQWGRERGRLQPVGFTEKQHRDFPPQ
AHRARTSSLSSLRPTLGCLRPSHSTAGDPSPVRRYPTRKQRSRSHRPHAAPVVSDPTSPR
GSGDEGLLPSSAAGRFSLTRMLLLLSLVTGLALSASDVVTETGADPSSALLHDIQRKVND
LWQSLLYPVMADNETDGLTYATCEVKPSSKIDADKPQVTGQVLFRQHYSQGKLEAIFHLD
GFPLDNNQSGRAIHIHELGDLSDGCNSAGGHYNPFGVNHPRHPGDFGNFSPKDGKIRKYK
PNLFATMFGPYSILGRSVVIHEQEDDMGKGNNKASLENGNAGKRLACCVIGICNKNLWEE
KQSEAMDRKKRWRRTRLS
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacgatgtgtgccagccggcttctgggaaacggcctctctgggcccccactgac
gtctgccgcctcaccactgcttgggaaacagggagaaaacagcttcagtggggcagggaa
cggggcagactgcagcccgttggcttcacagagaagcagcaccgcgattttcccccccag
gctcacagagcaaggacaagcagcttatccagcctgagaccaactcttggttgcctccgt
ccctcccacagcactgccggtgacccctcccctgtgcggcgttacccaactcgcaaacaa
cgctcccgctcacatcggccccacgcagctccggttgtgtccgatcccacctcgccgcgg
gggagtggagacgaagggctgctgccgagcagtgctgcgggcaggttctcactcaccagg
atgcttctgcttctttctctggtcactgggctggccctgtctgcctctgatgtcgtgaca
gaaacaggagccgatccaagcagcgcgttacttcatgacatacagagaaaagtgaatgac
ctctggcagagcttgctctatccagtgatggctgataatgagactgatgggctgacctac
gccacctgtgaagtgaagcccagctccaaaatagatgctgacaagccacaagtgactgga
caagtcttattcagacagcattactcacaaggaaaattagaagccatttttcacttggat
gggtttcctctggataacaaccagtctggcagggccatacacatccatgagctcggagat
ctcagcgacggctgcaactccgcgggaggacactacaacccctttggagtgaaccacccc
cgccacccaggggacttcggcaacttttctcctaaagatggcaagatcagaaaatacaaa
cccaacctcttcgccacaatgtttggtccgtactccatcctgggcagatccgttgtgatc
catgagcaggaagatgacatgggcaagggcaataacaaggccagtctggaaaatggaaat
gctggcaaacgtctggcgtgctgcgtgattgggatctgcaacaagaacttgtgggaggag
aaacagtctgaggctatggacaggaagaaaagatggcgccgaaccaggctcagctga

DBGET integrated database retrieval system