KEGG   Gallus gallus (chicken): 423232Help
Entry
423232            CDS       T01006                                 

Gene name
GANC
Definition
(RefSeq) neutral alpha-glucosidase C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00052  Galactose metabolism
gga00500  Starch and sucrose metabolism
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    423232 (GANC)
   00500 Starch and sucrose metabolism
    423232 (GANC)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     423232 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110 NtCtMGAM_N POC3_POC4
Motif
Other DBs
NCBI-GeneID: 423232
NCBI-ProteinID: NP_001186594
CGNC: 6871
Ensembl: ENSGALG00000009036
UniProt: E1BTT7
LinkDB All DBs
Position
5
AA seq 914 aa AA seqDB search
MEAAAQGEASIQDEAVDKSNFKECNQIAFYRRQKLLHPGKSLYRALLDTVTLSDENVKFH
IIHEENKVLLQVEIYEIEGNIFRLKINEAAPLRARYEVPDVLIKEPTTQKLSMSQKEGGI
LVLTSVNGDYKLRVTANPFQVELQFKDETVLSMNSNGLLYFEHLQPPPSDRKPTAENEEA
ASDSSKDNQEDLGLWQERFGSFLDIKAHGPSSVGMDFSLHGFDHLYGIPQHTESLLLKNT
SDGDAYRLYNLDIFGHKIHDKIGIYGSVPLLIAHKPDRTSGIFWLNSSETLVDINTKAVA
EHIPTESAADISKQRAVPVTDVRWMSESGIIDVFLLMGPTAFDIFKQFAQLTGTQALPPL
FSLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDVIWLDIEHTDGKRYFTWDKKKFQNPKK
MQELLRKKKRKLVVIVDPHIKADPMYTLYSQGKEKGYFVKDRNGKDFEGICWPGSSYYLD
FTNPEVRKWYADQFAFKTYKGSTNILFVWNDMNEPSVFKGAELTMQKDAVHYNNWEHREL
HNLYGFYQQMATAEGLIKRSSGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWGYLKISIP
MLLTISMAGISFCGADVGGFIGDPEPELLVRWYQAGAYQPFFRGHSNMKSKRREPWLFGE
KNTQIIREAIRERYVLLPYLYTLFYRAHTEAEPVMRPLWIEFPEKLETFGVEDEYMLGNA
LLVYPVTDKEAKAVSVLLPGLEEVWYDFRKFKRMEDRGTLKIPVTLENIPIFQRGGTVIP
LKTAAGKSTEWMTNISYELRVALNTEACAVGELYLDDGHSFQYLHKKQFLYRKFTFHKNI
LSSSCTDESGQYRTTCVVERVIFLGLGQRPTFVTACSKGGKEKEVVFTYDTKTAVLILEN
LALRVDSDWEICIK
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggccgcgcagggggaagccagcattcaagatgaagctgtggacaaaagcaac
tttaaggagtgcaaccagattgctttctacagacgtcagaaacttctacatcctggaaaa
tccttgtatcgagcactgttggatacagtcacattaagtgacgagaatgtcaaattccat
attattcatgaggagaataaggttcttctacaagtagaaatctatgaaatagaaggcaat
atttttaggcttaaaattaacgaggcagctcctctgagagcaagatatgaagttcctgat
gttcttataaaggaacctacaacccagaaactctctatgtcccagaaggagggaggtatt
ttggtgttgacaagtgttaatggggactacaagcttcgagtcacagcaaaccccttccag
gttgagctacagttcaaggatgagactgttctgagcatgaattccaatgggttgttatat
tttgagcacctacaaccacctccaagtgatagaaaacctacagcagaaaatgaggaggca
gcaagcgattcctctaaggataatcaggaggatctaggtctctggcaagagagatttggc
agtttcttagacatcaaagctcatggtcctagttctgtaggcatggacttctctttacac
ggatttgaccatctttatggaataccacaacacacagaatcacttcttctcaaaaacaca
agtgatggtgatgcataccggctttataatttggatatctttggccacaagatacatgac
aagataggtatttatggttcagtgccacttctcatagcacacaagcctgacagaacttca
gggatcttctggctgaattcttcagaaacactggtggatattaatacaaaggcagtagct
gagcacatacccaccgaatctgctgcagatatttctaagcagagggcagtgcctgtaact
gatgtgcgctggatgtcagaaagtggaatcattgatgtttttctgctgatgggacccacg
gcatttgatatcttcaagcagtttgcacaactgacaggcactcaagcactacctcccctc
ttttctctgggctaccatcagtgccggtggaattatgaagatgaacaagatgtcaaggca
gttgatgcaggttttgatgaacatgacattccttatgacgtgatatggctggacatagaa
cacacagatggcaagaggtatttcacctgggacaagaaaaaattccagaaccccaagaaa
atgcaagaacttctcaggaagaaaaaacgcaagcttgtcgtcattgtagatccccatatt
aaagctgatcctatgtataccctgtattcacagggaaaagaaaagggatattttgtgaaa
gacaggaatggaaaagattttgagggcatctgttggccaggttcctcttactatctcgat
ttcaccaatcctgaagtgcgaaaatggtatgcagatcaatttgccttcaaaacatacaag
gggtccactaatatcctctttgtgtggaacgacatgaacgagccgtcagttttcaaaggg
gcagagctaacaatgcagaaggatgctgtgcactataacaactgggaacatcgggaatta
cacaacctctatggattctaccagcaaatggcaactgctgaaggactcatcaaacgttct
tccggaaaagagagaccatttgttctcacacgatctttctttgctggatcacagaagtat
ggggcagtgtggaccggagacaacacagcagaatggggttacttgaaaatctccattcca
atgcttctcaccatcagcatggcaggcatttcattctgtggagctgatgtgggagggttc
attggagatccagaaccagaattacttgttcgctggtatcaggctggagcctaccagccc
ttcttcagaggtcattctaacatgaagagcaaacggcgagaaccgtggctctttggggag
aagaacacccagatcatcagggaagccattagagagcgctacgtcctcctgccatactta
tacacactgttctatcgggcacacacagaggctgaaccagttatgaggcctctctggata
gagttcccagagaaattagaaacttttggagtggaagatgaatacatgttaggaaatgct
ttgttggtctatccagtcacggacaaagaggccaaggcagtgagtgttctgcttccaggg
ttggaggaggtttggtatgatttcagaaaatttaaacgaatggaagatcgaggcaccctg
aagatcccagtaacgctggagaatattcccatattccagcgagggggcactgtgatacct
cttaagaccgcagctggaaaatccactgaatggatgacaaatatttcttacgaactccgc
gtggcactgaacacagaggcctgtgcagtaggtgagctctacctagatgatggacattca
tttcagtatctccacaaaaagcagttcctgtaccggaaattcacttttcacaagaacatt
ctttcctccagctgcacagatgagagcggacaataccgtaccacgtgtgtagtcgagcgg
gtgatatttctgggacttggacaacgacccacttttgtgacagcctgttccaagggtggg
aaagaaaaagaagtggttttcacatatgacacgaagactgctgtgctgattctggaaaat
ttagccctgagagttgatagtgactgggagatttgtatcaagtga

DBGET integrated database retrieval system