KEGG   Gallus gallus (chicken): 424294Help
Entry
424294            CDS       T01006                                 

Gene name
LCT
Definition
(RefSeq) lactase-phlorizin hydrolase precursor
  KO
K01229  lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00052  Galactose metabolism
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    424294 (LCT)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.62  glycosylceramidase
     424294 (LCT)
    3.2.1.108  lactase
     424294 (LCT)
Chaperones and folding catalysts [BR:gga03110]
 Intramolecular chaperones
  Others
   424294 (LCT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 424294
NCBI-ProteinID: NP_001104816
CGNC: 9311
Ensembl: ENSGALG00000012260
LinkDB All DBs
Position
7
AA seq 1935 aa AA seqDB search
MELVCKTVVFFLLVSTSLGIDGELAQDFVAIAGPLPTTLAHRLHLQSHILPKEALDPTVS
EAHDDFCQQDTVISQLPQYFSHLREIGVTHYKVFLPWARILPDGDAKKPDEAQVRCYQEL
LKMLVAADLRPVIVLHHKGVPDTVAVGRKASSFADLFVDYAEFSFYVFGGLADMWLTFSD
LPELLESLPYSDSQVRVQALAAAHERAYSVYHKKYSFQGGKLSIALGHDDIPSVKTKPPI
SCSFHLEHESVDFLSLSLQYWCGNETDFYLKMSEFQNVWKDTEVLLFSLKFLDCGSLEEN
PFIPVAAIVAAINKEKARTIGYDVNEFLDFSSRKLRTSEAGLTGFSLSSYTLQENLSAAI
APRSSYQTVWEMFANQSELERDTFLQDVFPSGFLWGTSTGAFNIEGAWAEDGKGESIWDQ
FGHEGHVYMNQTTDVACDSYHKTSYDVYLLRGLHPQLYKFSISWPRIFPAGTNETIGLKG
VDYYNQLIDRLLEANIEPMVTLFHWDLPQALQVLGGWQNDSIIDAFANYADFCFTTFGDR
VKFWVTFHEPWVISYAGYGTGEHPPGITDPGIASYKVAHTILKAHAKVWHLYNDRYRSQQ
QGRVGLVLNSDWAEPQTPANSEDVKASERYLQFMLGWFAHPIFVNGDYPDILKAQIQEVN
QQCSTTVAQLPVFTEEEKTWVKGTADFFGLSHYTSHLVTAVTNGTCTPGYESIGNFSLHV
DPSWPKTASSSIHVVPWGLRRLLKFVSQEYTGTKIPIYIAGNGMPTEAVGDLINDTLRVD
YFRRYINEALKAIKLDAVDVQSYIARSLIDGFEGPGGYSLKFGLHHVNFEDSNRPRTPKA
SAYFYSSVIENNGFPSKVSDRSSTSVVFGLPTPSKLPSLPASEVPSKSKVVWQKFSSQTD
FERDMYVYGTFPKDFTWGVSSSAYQIEGGWDADGKGPSVWDNFTHVPGNIKNNDTGDIAC
NSYNKVEEDIYLLRALGVKNYRFSLSWPRIFPNGRNNSINSHGVDYYNRLIDGLVANNIT
PIVTLYHWDLPQALQDIGGWENSELIELFDSFADFCFQTFGDRVKFWLTFNEPQVIAWVS
YGTGEFPPNVNNPGSAPYEVAHTLLKAHARVYHTYDDKYRASQGGVISLCLNIDWIEPKT
PSNPRDLEAADRYMQFLVGWFAHPVFKNGDYPEVMKWTVGNRSELQNLPSSRLPVFTAEE
REYIRGTADVFCLNTYTAKLVTHATTRLNPFSYEYDQEISTDVDSSWPTSALAGHRAVAW
GLRRLLNWVKEEYGNPPMYIIENGVGIKTKSDVDDHTRILYYKTYIDEALKAYKLDGVNL
RGYNAWSFMDFFEWLNGYEPRFGLHEVDFNDPNRPRTPRRSAVYYAEIIRNNGIPLPEEN
KFLYGEFPKNFCWSVATAAYQIEGAWRADGKGLSIWDKYTHTPLKISNDDNGDVACDSYH
KIEEDVEMLKRLKVSHYRFSISWSRVLPDGTTRYINEMGLNYYERLIDALLAANITPQVT
LYHWDLPQALQDIGGWENDTIVQRFKEYAELLFQRLGDKVKFWITLNEPYNTAYLGYGFG
TAAPGISVRPGRAPYVVGHNLIKAHAEAWHLYNETYRAKQGGLISITINSDWAEPRNPHK
QEDFDAARQYLQFLIGWFAHPIFKNGDYNEVMKTRIRERSLAQGLSSSRLPEFTESEKQR
IKGTYDYFGLNHYTTVLAYKYEYSTGILSYDADRGVASVTDRSWLNSGSFWLKVTPFGFR
KLLQWIKEEYNNPPIYVTENGVSERGAIDFNDTWRIHYYQNYINEALKAVVLDGVDLRGY
TAWTLMDNFEWAVGYDERFGFYHVNYTDPTLPRLPKASARYYSQIISCNGFPDPATGPHP
CLETEPDVIPDTTPGLADSVRFLGLDLTSQRAEIALYVLFALSAIGALGLALISYKYGTI
SKRYHKQSSMELSKM
NT seq 5808 nt NT seq  +upstreamnt  +downstreamnt
atggagctggtttgtaagacagttgtctttttcttgttagtctctactagccttgggata
gatggggaattagctcaggactttgttgccattgctggacctctgcctaccaccttagca
cacagattgcatctgcagagccacattctacccaaagaagctttggaccctactgtgtct
gaagcccatgatgacttctgtcagcaagatactgtgatttcccaactgccccagtacttc
tcccacctccgtgagattggggtaacacattacaaagtcttcttgccatgggcacgcatt
cttcctgatggggatgccaagaagccagacgaagctcaagtgcgatgctaccaggagctg
ctcaaaatgctggttgctgcagacctcaggccagtgatagttctccatcacaagggtgtt
cctgacactgtggctgtaggcaggaaggcgagctctttcgctgacctttttgtggactat
gcagagttcagtttctatgtttttggaggtctggctgatatgtggctcaccttcagtgac
ctgcctgagctcctggaaagcctgccttacagtgactctcaggtccgtgtccaggccctg
gctgctgctcatgaaagagcttacagtgtttaccataagaaatattctttccaaggtgga
aagctgtccattgctttaggacatgatgacatcccttctgtaaagaccaaaccccccatt
agctgttcttttcacctagagcatgaatcggtagacttcctgtctcttagccttcagtat
tggtgtggaaatgaaacagatttctacttgaaaatgagtgaattccagaatgtctggaag
gacacagaggtattgctgtttagtctaaagttccttgattgtggttccttggaagagaat
ccgttcataccagtagctgccattgtcgctgctattaataaagagaaggcacgtacaatt
ggatatgatgtgaatgaattcttggacttctcatctcgtaagctaaggactagtgaagca
ggattgactggttttagcttatcctcatatactctacaagagaatctaagtgctgctatt
gcccctcgctcctcctatcaaacagtctgggaaatgtttgctaaccaatctgaattggag
agggatactttcctacaagatgttttcccaagtggtttcctctggggcacgtccacaggt
gcctttaatatcgaaggagcctgggcagaggatgggaaaggagagagcatctgggatcag
tttgggcatgaaggtcatgtctacatgaaccaaacaacagatgtggcatgtgacagctac
cataaaaccagctatgatgtttatttgcttagaggtcttcatccccagctgtacaagttt
tctatatcctggcctagaattttccctgctggcaccaatgaaaccatcggcctcaagggt
gtggattattataaccaattaattgacaggttgctagaggctaacattgagcccatggtg
actcttttccactgggacctcccacaggctcttcaggttcttggtggctggcagaatgac
agtatcatagatgcatttgcaaactacgcagacttctgctttaccacttttggggatcgg
gtcaagttttgggttactttccacgagccttgggttatcagctatgctggctatggcacc
ggagagcatcctccaggaatcactgatccaggaatagcatcttacaaggtggctcacaca
attctcaaggctcatgctaaggtctggcacctgtataatgacagataccgttctcagcag
cagggaagggtagggctggtgctgaactcggattgggctgaaccccaaactccagccaac
tctgaggatgtgaaggcatcagagagatacctgcagttcatgcttggctggtttgctcac
cctatatttgttaatggtgactacccagatatcctgaaggctcagatccaggaggtaaac
cagcagtgctccacaacagttgcacagctgcctgtgtttacggaggaggagaaaacctgg
gtgaaaggaacagcagatttttttggcctttctcattatacttcccacttggttactgct
gtgactaatggtacctgcacaccaggatacgaaagcatcgggaacttctctttgcacgta
gatccttcttggccaaagactgcctcttcttcaatccatgtggtcccatggggattaaga
aggctgctgaagtttgtgtcccaggaatatacagggacaaaaatcccaatttacatagca
ggaaatggtatgccaacagaagctgtaggggatcttattaatgacactctacgagtggat
tatttccgccgatacatcaatgaggctctaaaagcgataaaactagatgcagttgatgtt
cagtcatacattgctcgatccctgattgatggctttgaaggtccagggggctacagccta
aaatttgggctacatcacgtgaattttgaagacagcaacagaccaaggactcccaaggca
agtgcttacttctattccagcgttattgaaaataatggtttcccatccaaagtctcagac
agaagttctacatcggtggtgtttggcctacccacgccatcaaagttgccaagtctacca
gcatcagaagttccctccaagtcaaaggttgtctggcagaagttttcatcccaaacagac
tttgagagggacatgtacgtttatgggacattcccaaaggattttacatggggtgtgtcg
tcttctgcataccagatagagggaggttgggatgcggatggcaaaggacccagtgtttgg
gataacttcacccatgtaccaggaaacataaaaaacaacgacactggagatatagcttgt
aatagctacaacaaggtagaggaagatatttacctgctgagagccttaggggtaaagaac
tatcgtttctctctgtcctggcctcgaattttccccaatggaaggaacaattcaataaac
agccatggtgttgattactataaccgtctcattgatgggctggtcgcaaacaacatcact
ccaattgtcaccctgtaccactgggacctgccacaagctctccaggacattggtggctgg
gagaacagtgagctgattgaactgtttgacagttttgcagacttctgtttccagaccttt
ggggacagggtgaagttctggcttacattcaacgaaccccaagtcattgcctgggttagc
tatgggacgggtgaatttccacccaatgtcaataatcctggtagtgctccctatgaagtg
gcacacaccttactgaaagctcacgccagagtctaccacacgtacgatgacaaatacaga
gcgagtcagggaggggtcatttctctgtgtctcaatattgattggattgagccaaagacg
ccaagcaaccccagggacctagaagctgcagacaggtacatgcagtttttggtggggtgg
tttgcacatccagttttcaaaaatggggactaccccgaggtcatgaaatggacagtcggg
aacaggagtgagctccagaacctgccatcatcccgcctaccagttttcacagctgaagag
cgtgagtacatcagaggcacagcggatgttttctgtttgaacacctacactgccaaactt
gtaacccacgcaacaacccgtctgaatcccttctcttatgagtatgaccaggaaatatca
acagatgttgacagctcctggcctacctcggctcttgctggccatcgggctgtggcctgg
gggctgaggaggctgctgaactgggtcaaagaagagtatggaaatccccccatgtacatc
attgagaatggagtggggataaagaccaaatcagatgtcgatgaccacaccaggatactt
tactacaaaacatacattgatgaagctttaaaagcttacaaactggacggtgttaatctg
agaggatacaacgcttggtcttttatggatttctttgaatggttgaatggttatgagcca
agatttggattgcacgaggttgattttaatgatcccaacaggccaagaaccccaaggcgc
tcggctgtgtactatgcagaaatcattcgcaataatggtatcccgttgccagaagaaaat
aaatttttatatggggagtttccaaagaacttctgttggagtgtagcaacggctgcatat
cagattgagggagcatggagagcagatgggaaaggacttagcatctgggacaaatacacg
cacactcctttgaaaatcagcaatgatgacaatggagatgtagcttgtgacagctaccac
aagattgaggaggatgtggagatgctgaaacgcctcaaggtgtctcactatcgcttttca
atctcctggtcccgtgttctcccagatgggaccaccagatacatcaatgaaatgggattg
aactactatgaaaggctaattgatgctcttctggcagccaatattacacctcaggtcact
ctctatcactgggacctcccccaggcactgcaggacatcggtgggtgggagaatgatacc
atagttcagaggtttaaggaatatgctgagctccttttccagagactgggagacaaagtg
aaattttggataaccctcaatgaaccctacaacactgcatatcttggctatggctttggc
acagctgctccaggtatctcagttagacctgggcgagccccctatgtggtggggcacaac
ctaatcaaggcccatgcagaagcctggcacctctacaatgagacttaccgtgcaaaacaa
ggagggctgatctccatcaccatcaactctgactgggctgaaccaaggaacccacacaaa
caggaggattttgatgctgccagacaatacttgcagtttcttataggttggtttgctcat
cccattttcaaaaacggcgattataacgaggtgatgaagacgaggattcgggaacgcagc
ctggcccagggtctgagcagctcccgacttccagaatttactgaaagtgaaaagcaaaga
attaaaggcacatatgactactttggtctaaatcattatactacagttttagcatacaag
tatgagtattctactggtattctatcgtatgatgctgacaggggtgttgcctcagtaact
gaccgcagctggctgaactctggttccttctggctaaaggtgacgccgtttggcttccga
aagctcctgcagtggataaaggaagagtacaacaaccctcctatttatgtgactgaaaat
ggggtatcagagaggggagccatagatttcaatgacacttggcgaatacattactatcag
aactacattaatgaagcgctgaaagctgtcgtgcttgatggtgttgatctgcgtggctac
acggcatggacgctgatggacaactttgagtgggcagtgggctatgatgaaaggtttggg
ttctaccacgtgaattacacggaccccacgctgccacggctccccaaggcctccgccagg
tactactcacagatcatcagctgcaacggctttccagatcctgcaacaggcccacatccc
tgtctggaaacagagcctgacgtgataccagacaccacaccaggactggctgacagtgtg
cgctttctgggattagatttaacatcacaaagagcagaaatagcactgtatgtgctattt
gcactttctgcaattggagcactgggcctggcacttatttcatataaatatggaacaata
tccaaaagatatcataagcaatcatccatggaactcagtaaaatgtag

DBGET integrated database retrieval system