KEGG   Gallus gallus (chicken): 424321Help
Entry
424321            CDS       T01006                                 

Gene name
GPD2
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    424321 (GPD2)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     424321 (GPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 EF-hand_1 EF-hand_6 FAD_binding_2 GIDA FAD_oxidored Pyr_redox_2 EF-hand_8 EF-hand_5 NAD_binding_8 Pyr_redox_3 HI0933_like EF-hand_9 FAD_binding_3 Thi4 Pyr_redox Gly_acyl_tr_N
Motif
Other DBs
NCBI-GeneID: 424321
NCBI-ProteinID: XP_015145680
CGNC: 9521
Ensembl: ENSGALG00000012543
UniProt: F1NCA2
LinkDB All DBs
Position
7
AA seq 727 aa AA seqDB search
MAFQKAVKGTVLIGGGAIATVFGLSQFSQYRNKHGSLVNVQAAEAVTVPIKNDFPTREEQ
ISTLKSTPEFDVLIIGGGATGCGCALDAVTRGLKTALLERDDFSSGTSSRSTKLIHGGVR
YLQKAIMKLDFEQYKMVKEALQERANLLEIAPHLSAPLPIMLPVYKWWQLPYYWIGIKLY
DLVAGSQCLKRSYVLSKSRALEHFPMLRKDKLVGAIVYYDGQHNDARMNLAIALTAARYG
AATANYTEVLRLLKRTEPGSGKQRVCGARCRDVLTGQEFDVKAKCVINATGPFTDSVRKM
DDQEVPNICQPSAGVHIVMPGYYSPDNMGLLDPATSDGRVIFFLPWEKMTIAGTTDSPTD
VTSHPIPTEEDINFILSEVRNYLSVDVEVRRGDVLAAWSGIRPLVTDPNSKDTQSICRNH
VVAVSDSGLVTIAGGKWTTYRAMAQDTIDAAIQAHNLPAGSSKTIGLLLQGAEDWSPTLY
IRLVQDYGLESEVAQHLASTYGDKAFEVAKIAQVTGKRWPIVGKRLVSEFPYIEAEVIYG
VKEYARTAVDIISRRTRLAFLNVQAAEEALPRIVDIMGKELNWNEQKKKEELEAARKFLY
YEMGYKVKSDQLTDSSEITLMPSDIERYKKRFHMFDKDKKGFITILDVQRVLESISVQID
EKTLHDILNEVDLNKNGQVELIEFLQLMSAIQKGHVSGSRLAVLMKTAEENLRQRVVIPV
DRSGGGL
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggcatttcagaaggcagtgaaaggaactgttctcattggaggaggtgccatagcaaca
gtttttggcctctctcaattttctcagtatagaaacaaacacggatccttggtgaatgtt
caagctgcagaagcagtgactgttcccataaagaatgattttcctacaagagaagagcag
atttcgacactaaaaagtacacctgagtttgatgttcttatcataggtggaggagcaaca
ggatgtggttgtgccttagatgcagtcactagaggactaaaaacagcccttctagaaaga
gatgatttctcatcagggaccagcagcaggagtactaaattgatccatggtggagtgaga
tatcttcagaaggccatcatgaagttggattttgagcagtacaagatggtgaaagaagca
cttcaggagcgtgcaaacctacttgaaatagctcctcacctatcagctcctttgcctatc
atgctgcctgtttacaaatggtggcagttgccgtattactggattggaataaaactgtat
gacctcgtggcaggaagtcagtgtctgaaaaggagttacgtcctcagcaagtcaagagcc
ttggagcactttccaatgctgcgcaaagacaagcttgttggagctattgtctattatgat
ggacagcacaacgacgcgcggatgaacctcgccatcgccctcaccgctgccaggtacggc
gctgccaccgccaattacactgaagtgctgcgcctgctgaagaggacggagccgggcagc
ggcaagcagcgcgtgtgcggggcgcgctgcagggatgtcctcacagggcaggaatttgat
gtcaaagccaaatgtgttatcaatgctacaggacctttcacagactcggtgcgcaaaatg
gatgatcaggaagtgcccaacatctgtcagcccagtgcaggcgtgcacattgtgatgccg
ggctattacagccctgataacatgggtctgcttgacccagccaccagtgacggcagagtg
attttcttcctgccttgggagaagatgactattgcagggaccacagacagccccaccgat
gtcacctcccatcccataccgacagaagaagacataaacttcattctgagtgaagtgcgc
aactacctgagtgttgatgttgaagtgagaagaggagatgtgttggcagcgtggagtggc
atacgtcctctggtcaccgaccccaactccaaggacacgcagtcgatatgccggaaccac
gttgttgctgttagtgacagtggccttgtcaccatagcaggtgggaagtggacaacatac
cgtgccatggctcaggatacaattgatgctgctattcaggcacacaatctgcctgcgggt
tccagtaagacaattgggctgctgctccaaggggctgaggactggagccccacactctac
attaggttggtccaagactatggacttgaaagcgaggtggctcaacatctagcttctaca
tatggtgacaaggctttcgaggtggccaaaatagcccaagttacaggaaagagatggcct
attgttggaaaacgtcttgtttctgagtttccttatatcgaagcagaggtcatctatggt
gtgaaggagtatgcccgcactgccgtggatatcatttcccggcggactcgcttggccttc
ctgaatgtgcaggctgctgaggaagctctgccaaggatcgtagatataatggggaaagaa
cttaactggaatgagcagaaaaaaaaggaggaacttgaagctgcgaggaaatttctgtat
tatgaaatgggctacaaagtaaaatctgaccaactaacagacagctccgaaatcactctg
atgccttcagatattgaaaggtacaagaagcgattccacatgtttgacaaggacaagaaa
gggtttattactatactggatgtgcagcgtgtcttggagagcatcagtgtgcagattgat
gaaaaaacactccatgatattctgaatgaagtagatctgaacaagaatgggcaggtggag
ctcattgagtttttgcagctgatgagtgccattcagaagggccacgtctccggcagcagg
ctggctgtgctcatgaagacagcagaggagaacctgcggcagcgcgtggtgatcccggtg
gaccgcagcggcggagggctgtag

DBGET integrated database retrieval system