KEGG   Gallus gallus (chicken): 424412Help
Entry
424412            CDS       T01006                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    424412 (CACNA1E)
   04020 Calcium signaling pathway
    424412 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    424412 (CACNA1E)
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   424412 (CACNA1E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Motif
Other DBs
NCBI-GeneID: 424412
NCBI-ProteinID: XP_015145962
CGNC: 2805
Ensembl: ENSGALG00000003833
LinkDB All DBs
Position
8
AA seq 2425 aa AA seqDB search
MLGLGTCSVSAPGRAAEPAASPHYALALPEEEMWREHRLALMHSTQSCNLLEPQSLAEVL
VSRATSFDALYQPRDADGDSGSALDLGLGTYVPISPDVIKRRRGGLIEQRDIIKAHEAHK
MQSTPQARRKEWEMARFGEAVAGRLGSGDGGSEQNRSRQGAAAPAGGSPGAFKQTKAQRA
RTMALYNPIPVRQNCFTVNRSLFLFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLA
LEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFVFHKGSYLRNGWNVMDFIV
VLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLL
LFFAILMFAIIGLEFYSGKLHRACYTNNSGELEELDPPHPCGVQGCPPGYECREWIGPND
GITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVL
GVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSAL
EVLRRATIKRNRTDAMNRDSSDEHCVDISSVGERRLAQRRPLHPTLGNPLSRSGLKGVDG
ASYLRHKERLLRISVRHMVKSQVFYWIVLSLVALNTACVAIVHHNQPAWLTHFLYYAEFL
FLGLFLLEMSLKMYGMGPRLYFHSSFNCFDCGVTVGSIFEVVWAIFRPGTSFGISVLRAL
RLLRIFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGGFNFIDG
TPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVRSGMWSSIYFIVLTLFGNYTL
LNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPAIERDRRRRH
HMSMWEPRSSHLRERRRRHHMSVWEQRTSQLRRHMQMSSQEGINKDEPPLINPHASIFRR
KKPGDGVALEKCDEEQGGKGERPPAEGPEQPAPGTNPGGGEDRKSPSPRARRDKEMWQHK
ACHGNCEPGEEGAGGGIEERARMRQSQRRSRHRKARMEGKETTGALESRAGSQEMGLEEP
CPAEGMQDGERRGDSAAALDLIQGELEASGDPTRTNGVPAEEGSLPASAPEPSRGMEGSL
GEQDCSSPDTSEQALLGGAALGASRTVSHSEPDLSSVTANTEKATESTTIMIDVQDSTVV
QISNKTDGEASPLKEAESKEDEEEMEKKKRKKEKSETGKAMVPHSSMFIFSTTNPVRRAC
HYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSDRNKVLRYFDYVFTGVFTFEMVIKMI
DQGLILQDGSYFRDLWNILDFIVVVGALVAFALANALGTNKGRDIKTIKSLRVLRVLRPL
KTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTE
KDCIGNYVDHEKNKMEVKCREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDVTE
EDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEKNERAC
IDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYYSAPYTY
ELALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFITVIGSITEIILTDTKLVN
TSSFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGM
QVFGNIKLDEESHINRHNNFRSFLGSLMLLFRSATGEAWQEIMLSCLEGKGCEPDTTATS
GQNENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVR
IWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAEDMTVHFT
STLMALIRTALDIKIAKGGADWQQLDSELQKEILTIWPHLSQKMLDLLVPMPKTSDLTVG
KIYAAMMIMDYYKQSKAKKQRQQLEEQKNAPMFQRMEPSSLPQEIISNAKALPYLQQETL
TGLSSRSGFPSLSPLSPQEIFQLACMDPAHGQFQEHQSLEPEVREFQRVQPSNRGSYLPV
DTQDHAVSGRASSMPRLTVDPQVVTDTSSMRRSFSTIRDKRTNTSWLDEFSMERSSDNTY
KSRRRSYHSSLQLSARRLNADSGHRSEGHRSGGRERGRSKERKHLLSPDISRCNSEERSP
QAHDESPERRRESRSPSEGRSQTPNRQGTGSLSESSIPSISDTSTPRRGRRQLPPVPPKP
RPLLSYASMLRHAAGDASPPPDETEGGSPLLSKEPNATGLTESSSSPAGKPSRPSTPQRY
ISEPYLALHDDSHASDCGEEETLTFEAAVATSLGRSNTIGSAPPLRHSWQMPNGHYRRRR
RGAGQGVMCGASIDVLSDTEEDDKC
NT seq 7278 nt NT seq  +upstreamnt  +downstreamnt
atgctcggactcggcacgtgctccgtcagcgccccgggcagggcggctgagccggccgca
tccccccactacgcactggctctgcccgaggaggagatgtggcgcgagcaccgactcgcc
ctgatgcacagcacccagtcctgcaacctgctggagccccagagcctggctgaggtgctg
gtctcccgtgcgaccagcttcgatgccctctaccaaccccgagatgctgacggtgacagc
ggcagcgccttggacctggggcttggaacctacgtccccatcagccccgatgtcatcaag
cgccggcggggagggctgattgagcagagggacatcatcaaggcacacgaggcacacaag
atgcagagcacgccgcaggcaaggaggaaggagtgggagatggctcgcttcggggaggcg
gtggctggcaggctgggctccggggatgggggctccgagcagaaccgcagccggcaagga
gccgctgctccggcgggagggtccccgggagccttcaagcaaaccaaagcgcagcgagcc
cggactatggctctgtacaaccccatccccgtccggcagaactgcttcaccgtcaacaga
tcgttgttcctctttggggaagataacatagtcaggaaatacgccaagaagctcatcgac
tggcctcccttcgagtatatgatcctggcaaccataattgccaactgcatcgtgctggcc
ctggagcagcacctcccagaggacgacaagacacccatgtcacggagactggagaagacg
gagccgtactttattgggattttctgctttgaggctgggattaagatcgtggctctgggc
ttcgttttccacaagggctcatacctacgcaatggctggaacgtcatggacttcatcgtg
gtcctcagtggcatccttgccaccgctggaacacacttcaacacgcacgtagacctgcgc
accctgcgggccgtgcgtgtgctcaggcctctgaagctcgtctcgggcattcccagcctt
cagattgtgctgaaatccatcatgaaggccatggtacctctcctccagattggcttgctg
ctctttttcgctattctcatgtttgccatcatcggcctggagttttacagtgggaaactg
caccgagcctgctacacaaacaattcaggtgagctggaggagctggaccctccccacccc
tgcggggtgcagggctgtccgccgggctatgagtgccgggagtggattggtcccaatgat
gggatcacgcagttcgacaacatcctctttgctgtgctgaccgtcttccagtgcatcacc
atggaagggtggaccacagttctgtacaataccaatgatgccttaggagccacctggaac
tggctatacttcatccccctcatcatcattggatccttcttcgtcctcaaccttgtcctg
ggagtgctgtcaggggagtttgccaaagaacgtgagcgcgtggagaaccgccgggccttc
atgaagctgcggcgacagcagcagatcgagagggagctcaacggctaccgagcctggata
gacaaagcggaggaagtcatgctggctgaagagaacaaaaacgctgggacctcagcctta
gaagtgctcaggagagccaccatcaagaggaaccggacggatgccatgaaccgtgactcc
agcgatgagcactgcgtcgatatctcctccgtgggcgagcggaggctggcacagaggagg
cctcttcatcccaccttgggtaaccccttgagtcgctccggtctcaaaggagtagatgga
gcctcctatttacggcacaaggagcggctcctgcgcatttctgttcgtcacatggtgaaa
tcccaggtcttctactggattgtcttgagcctggtggctcttaacactgcctgtgtggcc
atcgtccatcacaaccagccagcctggctcacccacttcctctactatgcagagttcctg
tttcttgggctcttcctcctggagatgtccttgaagatgtatgggatggggccacgcctg
tacttccattcttcattcaactgtttcgactgtggggtcacagtgggaagcatctttgaa
gtggtctgggccatcttccgaccagggacctcttttgggatcagtgtcctacgagccctt
cgtctcctgcgaatatttaaaataaccaagtactgggcatccttgaggaatttggtggtc
tcgctgatgagctctatgaaatctattatcagcctgctcttcttgctctttctcttcatt
gtagtctttgccctgctgggaatgcagctgtttggaggcgggtttaatttcattgatggg
acaccatcggccaactttgacactttccctgcagccatcatgacggtgttccagatcttg
acgggtgaggactggaatgaggtgatgtacaatggcatccgctcccagggaggtgttcgc
tcgggcatgtggtcctccatctatttcatcgtcctcaccttgtttgggaactatactctg
ctgaatgtcttcttggccattgcagtggacaacctggctaatgctcaggagctcaccaag
gacgagcaggaggaagaggaggcctttaaccagaagcatgcccttcagaaagccaaggaa
gtcagccccatgtctgcccccaacatgcctgctattgaaagagacaggcgcaggagacac
cacatgtcgatgtgggagccgcgcagcagccacctgcgggagcggcgccggaggcaccac
atgtcggtgtgggagcagcgcaccagccagctgcgccggcacatgcagatgtccagccag
gagggcatcaataaggatgagccacccctcatcaacccacatgccagcatcttccgccgc
aagaagccgggggacggtgttgccttggagaagtgcgatgaagagcaaggcggcaagggt
gagcggccgccagctgagggtcccgagcagccggccccagggaccaacccaggcggtggg
gaggacaggaagagcccatcgccccgtgccaggagggacaaggagatgtggcaacacaaa
gcgtgccacgggaactgcgagccgggtgaggaaggggcaggaggtggcatcgaggagagg
gcgcggatgagacagagccagcggcgcagccggcatcggaaagccaggatggaggggaag
gagacgaccggagccctggagagccgtgcgggcagccaggagatggggctggaggagccc
tgccccgcagaggggatgcaggatggggagcggcgtggggattctgctgccgcgctggac
ctgattcagggcgagctggaggcgagcggggaccccaccaggactaatggggttcccgcc
gaggagggaagcctcccagcatcagcccctgagccttcccgggggatggagggcagcctg
ggtgagcaggactgcagcagcccagacaccagtgagcaggccctgctggggggggcggca
ctgggggccagccgcaccgtcagccacagcgagcctgacctgtcctccgtcaccgccaac
actgagaaggccaccgagagcaccaccatcatgattgatgtccaagactccactgtggta
cagattagcaacaagactgatggagaagccagccccttgaaggaggcagagagcaaagag
gatgaggaagagatggagaagaagaagcgcaagaaggagaagagcgagacgggcaaagcg
atggtgccacacagctccatgttcatcttcagcaccacaaacccggtgcgcagagcctgc
cactacattgtgaacctgcgctactttgagatgtgcatcctcctggtcatcgccgccagc
agcatcgccctcgcggccgaggatcccgtcctcaccaactccgaccgtaacaaagtgctg
aggtattttgattacgttttcaccggtgtcttcaccttcgagatggttatcaagatgatc
gaccagggcttgatcctgcaggatggctcctacttccgagacctctggaacatcctggat
ttcatcgtggtggtgggagctctggtggcctttgccttggcgaatgctttggggaccaac
aagggtcgggatatcaagactatcaagtctctccgtgtgctgcgggtcttgaggcccctg
aaaaccatcaagcggctgccgaagctcaaggctgtctttgactgtgttgtgacatccctc
aagaacgtcttcaacatcctcattgtctacaagctcttcatgttcatctttgctgtcatc
gccgtccagctcttcaaggggaagtttttctactgcactgacagctctaaggacacagag
aaggactgcatagggaactatgtggaccatgagaagaacaagatggaggtgaagtgccgg
gagtggaaacgacatgagtttcactatgacaatataatctgggcgttgctcaccctgttc
acagtctccaccggcgagggttggccccaggtgctgcagcattcggtggatgtgacggag
gaggaccgtgggcccagccgcagtaaccgcatggagatgtccattttttacgttgtctat
tttgtggtcttccctttcttcttcgtcaacatttttgtggctctcatcatcatcacattc
caagagcaaggagacaaaatgatggaggagtgcagtctggagaagaacgagagggcctgt
attgactttgccatcagtgccaagcccctcacacgctacatgccccagaaccggcacacc
ttccagtatcgggtctggcactttgtggtctctccatcctttgagtataccatcatggcc
atgattgctttgaacactgtggtgctgatgatgaagtactactctgctccatacacctat
gagctggccctgaagtacctgaacatcgctttcaccatggtgttctctttggagtgcgtc
cttaagatcattgcttttggcttcctgaattatttccgggatacctggaatatctttgac
ttcatcaccgtcatcggcagcatcacagagatcatcctgacagacaccaagctggtgaac
accagtagcttcaacatgagtttcctgaaactcttccgggcggctcggctcatcaagctg
ctgcgccagggttacaccatccgcatcctgctgtggacgttcgtgcagtccttcaaggct
ctcccctatgtctgcctcctaatcgcgatgcttttcttcatctatgccatcattgggatg
caggttttcggcaacatcaaactggatgaggaaagccacattaaccggcacaacaacttc
cgcagcttcctgggctccctcatgctcctcttcaggagtgccaccggtgaggcatggcag
gagatcatgctctcctgcctggagggcaagggctgcgagccggacacgacagcgacgtcc
gggcagaatgagaacgagcgctgcggcaccgacctggcctacgtctactttgtctccttc
atcttcttctgctcattcctgatgctcaacctgttcgtggcggtcatcatggacaatttt
gagtacctgactcgagattcctccatcctgggacctcaccatctagatgaatttgtccgg
atctgggcagagtatgacagagcagcgtgtggccgaatccattacactgagatgtatgaa
atgctgactcttatgtcaccaccgctaggcctcggcaagagatgtccttccaaagtggcc
tataagagactggtgctgatgaacatgcccgtggccgaggacatgacggtccatttcacc
tccaccctgatggcgctgatacgcaccgccctggacatcaaaattgccaaaggtggtgca
gattggcagcagttagactctgagcttcaaaaggagatcctgaccatttggcctcacctg
tcccagaagatgcttgacctgttggtacccatgccaaaaacctctgacctgactgttggc
aaaatatatgcagccatgatgatcatggattactacaagcagagcaaggcgaagaagcag
aggcagcagctggaggagcagaaaaatgcgcccatgttccagcgcatggagccatcctct
ttgccacaggaaatcatctccaacgcaaaggctctgccttacctccagcaggagaccctc
acagggctgagcagccggagcgggttcccctcgctgagcccgctctcaccacaggagatc
ttccagctggcgtgcatggatccggcccacgggcagttccaggagcaccagtctctggag
ccagaggttagggagtttcaaagagtgcagccctctaaccgtggcagctaccttcccgtg
gacactcaggaccacgctgtctctgggagggcctcctccatgcctcgtctcactgtggat
ccccaggtggtgacggacaccagctcgatgcggcggtcattttccaccatccgggacaaa
cgcaccaacacctcctggctggatgagttctccatggagcgcagcagcgacaacacctac
aagtcccgccggcgcagctaccactcctctctccagctctctgcccggcgcctcaacgct
gactcaggccacaggtctgaggggcaccgctcgggcggcagggagcggggccgatccaaa
gagcgcaagcacttgctgtcccctgacatctcccgctgcaactcagaggagaggagtccc
caggcacacgatgagtccccagagcggcggcgcgagtcccggtcacccagcgagggcagg
tcgcaaacgcccaaccggcagggaacgggctccctgagcgaaagctccatcccctccatc
tcggacaccagcacaccccggcgaggccgccgccagctcccacctgtgcccccaaaaccg
cgtcccctcctctcctacgcctccatgctgcggcacgctgccggagacgcctcaccacct
cccgatgagaccgaaggggggtccccgctcctctccaaggagcccaacgccaccggcctg
accgagtcttccagctccccggcggggaagccgagccggccgtccaccccgcagcgttac
atctcggagccctacctggccctgcacgacgactcgcacgcttcggactgcggcgaggag
gagacgctcaccttcgaggcggccgtggccaccagtctgggtcgttccaacaccatcggc
tcggccccaccgctgcgacacagctggcagatgcccaacgggcactaccggagacggagg
cgaggggccgggcagggcgtgatgtgcggggccagcatcgatgtgctcagcgacaccgag
gaagatgacaagtgctaa

DBGET integrated database retrieval system