KEGG   Gallus gallus (chicken): 425607Help
Entry
425607            CDS       T01006                                 

Definition
(RefSeq) procollagen galactosyltransferase 1
  KO
K11703  collagen beta-1,O-galactosyltransferase [EC:2.4.1.50]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00310  Lysine degradation
gga00514  Other types of O-glycan biosynthesis
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    425607
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    425607
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gga01003]
    425607
Enzymes [BR:gga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     425607
Glycosyltransferases [BR:gga01003]
 O-Glycan biosynthesis
  O-linked Gal type
   425607
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_25 Glyco_tranf_2_4 Anp1 Glycos_transf_2 CAP59_mtransfer
Motif
Other DBs
NCBI-GeneID: 425607
NCBI-ProteinID: XP_025002276
CGNC: 52509
LinkDB All DBs
Position
Unknown
AA seq 608 aa AA seqDB search
MAAGRCRALPLLLLAALGRAAAYFPEERWRPESPLRAPRVTVAIIARNAAHALPAVLGGL
ERLRHPKERTALWVAVDHSEDNTTALLREWLVRVQGLYHRVEWRPMEEPRSYPDEEGPKH
WSSSRYEHVMKLRQAALQSARDMWADYLLFVDADNVLTNPDTLGLLMAENKTVVAPMLDS
RAAYSNFWCGMTAQGYYKRTPAYLPIRKRERRGCFAVPMVHSTFLLDLRKEASRLLTFYP
PHPDYTWPFDDIIVFASSCKQAEVQMFVCNKEVYGFLPVPLRSHSTLQDETESFMHVLLE
IMVKNPPAEPSRYLSVPPKSPDKMGFDEVFMINLKRRADRRERMLRTLHEQEIACKVVEA
VDGKAMNSSEVEALGIKMLPGYKDPYHGRPLTKGELGCFLSHYRVWEEIVERGLGKSVVF
EDDLRFEIFFKRRLMNLMYDLEEEGVGWDLIYIGRKRMQVEQPERSVPHVRNLVEADYSY
WTLAYVVSLQGARKLLAAQPLSKMLPVDEFLPIMFNKHPVSDYMKHFKTRNLLAFSVEPL
LVYPTHYTGDDGYISDTETSVVWDNEKIKTDWDRAKSQKMKEQQELRREAKNSDVLQSPL
DSTARDEL
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggggcggtgccgggcgctgccgctgctgctgttggcggcgttgggccgcgcg
gccgcctatttccccgaggagcgttggaggcccgaatcgccgctccgcgccccacgcgtg
accgtggcgatcatcgccaggaatgcggcccacgcgctgcctgcggtgctcggggggttg
gagaggttgaggcaccccaaggagagaacggcgctgtgggtggcagtggaccacagcgag
gacaacacgacggcgctgctgcgcgagtggctggtgagggtgcaggggctgtaccaccgc
gtggagtggagacccatggaggagccacgctcctaccccgacgaggagggccccaagcac
tggtccagctcccgctatgagcacgtgatgaagctgaggcaggcggccctgcagtcggcg
cgggacatgtgggctgattacctgctgttcgtggatgctgacaacgtcctgacgaacccc
gacacgttggggctgctgatggccgagaacaaaacggtggtggcccccatgctggactcc
cgcgctgcctactccaacttctggtgtgggatgacggctcagggctactacaagcgcacc
cccgcctacctgcccatccgtaagcgggagcggcggggctgctttgctgtgcccatggtg
cactccaccttcctgctggacctgaggaaggaggcatcccggctgctcaccttctacccc
ccccaccccgactacacgtggcccttcgacgacatcatcgtcttcgcctcctcctgcaag
caggcagaggtgcagatgtttgtgtgcaacaaggaggtgtacggtttcctcccggtgccg
ctgcgctcgcacagcacgctgcaggatgagacggagagcttcatgcacgtcctgctggag
atcatggtgaagaaccccccagcagagccctcgcggtacctctccgtcccacccaaaagc
cccgacaagatgggcttcgatgaggtcttcatgatcaacctgaagcgccgggccgaccgc
agggagcgcatgctgcgcacgctgcacgagcaggagatcgcctgcaaggtggtggaggcg
gtggatgggaaggccatgaacagcagcgaggtggaagcgctgggcattaagatgctgccg
ggctacaaggatccgtaccacggccggccgctcaccaagggggagctgggctgcttcctc
agccactaccgggtgtgggaggagatcgtcgagagagggctggggaagtcggtggtgttt
gaggacgatctgcgcttcgagatcttcttcaagcggcgcctgatgaacctgatgtacgat
ttagaagaggagggtgtgggctgggatctgatttacatcgggaggaagaggatgcaggtg
gagcagcctgagaggtcggtgccgcacgtgaggaatttggtggaggctgattactcctac
tggactttggcctacgtggtttcgctgcagggagcccgcaagctgctggcggctcagccg
ctgtccaaaatgctgcccgtcgatgaattcctccccatcatgttcaacaaacatcccgtc
tccgactacatgaagcacttcaagacccgcaacctgctggccttttcggtggagccgctg
ctggtttatcccactcactacaccggcgacgacggctacatcagcgacacggagacgtct
gtggtgtgggacaacgagaagatcaagacggactgggatcgcgccaagtcccagaagatg
aaagagcagcaggagctgcgccgggaggccaaaaactcggacgtgctgcagtcccccctc
gacagcaccgcccgcgatgagctatga

DBGET integrated database retrieval system