KEGG   Gallus gallus (chicken): 426086
Entry
426086            CDS       T01006                                 

Gene name
LPAR2
Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04080  Neuroactive ligand-receptor interaction
gga04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    426086 (LPAR2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    426086 (LPAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    426086 (LPAR2)
G protein-coupled receptors [BR:gga04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    426086 (LPAR2)
SSDB
Motif
Pfam: 7tm_1 7tm_4
Other DBs
NCBI-GeneID: 426086
NCBI-ProteinID: NP_001108553
CGNC: 10093
Ensembl: ENSGALG00000042767
UniProt: A0A1D5PSL7
LinkDB
Position
30
AA seq 361 aa
MVEVRCGCRGCVCRPAAMKHCFYNESVGFFYNNSRKELTTYWRTKDILVVALGLTVSLIV
LLTNLLVIAAIIINRRFHYPIYYLLGNLAAADLFAGIAYMFLMFHTGPRTAELSLKTWFI
RQSLLDTSLTASVVNLLAIAVERHQTVLTMQLHSKMSNQRVMILIFCIWATALLLGLIPS
YGWHCLCALEECSSMAPLYSRSYLTFWAISNLLVFLLMAVVYAHIFIYVKRKMGRMSAHT
SFHPRYRETVVGLVKTVTIILGAFLICWTPGQVVLLLDGLGCKSCNVLAVEKYVLLLAEI
NSLINAIVYSYRDNEMRSTFRRILCTICYRNPKYTPTAVKPNGADRGSLSLNGHFTVDSS
I
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggtagaggtgcggtgtggatgcagggggtgcgtttgcaggccggcggccatgaagcac
tgtttctacaacgagtcggtgggtttcttctacaacaacagccggaaggagctcaccacc
tactggaggaccaaagacatcctggtggtggccctgggcctcactgtcagcctcatcgtc
ctcctcaccaacctcctggtcatcgccgccatcatcatcaaccgccgcttccattacccc
atctattacctcctgggcaacctggcggctgccgacctcttcgccggcatagcttacatg
ttcctcatgttccacacggggccgaggacggccgagctctccctgaagacctggttcatc
cggcagagcctcctggacaccagtctgaccgcttcggtggtcaacctcttggccatcgcg
gtggagaggcaccagacggtgctgaccatgcagctgcacagcaagatgtccaaccaacgc
gtcatgatcttgatcttctgcatctgggccacggctctgctgctggggctgatcccatcc
tacggttggcactgcctgtgtgccctggaggagtgctccagcatggccccgctctacagc
cgcagctacctgaccttctgggccatctccaacctcctcgtcttcctcctcatggcggtg
gtctacgcccacatcttcatctacgtcaagaggaagatggggaggatgtcggcgcacacc
tccttccacccgcgctacagggagaccgtggtcggcctcgtcaagacggtcaccatcatc
ctgggcgccttcctgatctgttggacccccgggcaggtggtgctgctgttggacgggttg
ggttgtaagagctgcaacgttttggccgtggagaaatacgtcctcctattggccgagatc
aactcgttgatcaacgccatcgtttactcctatcgggacaacgagatgaggagcactttc
cggaggatcctctgcaccatctgttataggaaccccaaatatacccccacggccgtgaaa
cccaacggagccgaccgtgggtcgctgtccctgaatgggcacttcacggtggattcctcc
atttga

DBGET integrated database retrieval system