KEGG   Gallus gallus (chicken): 426314Help
Entry
426314            CDS       T01006                                 

Gene name
SUV39H2
Definition
(RefSeq) histone-lysine N-methyltransferase SUV39H2
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    426314 (SUV39H2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    426314 (SUV39H2)
Enzymes [BR:gga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     426314 (SUV39H2)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     426314 (SUV39H2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    426314 (SUV39H2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 426314
NCBI-ProteinID: NP_001026541
CGNC: 52742
Ensembl: ENSGALG00000013920
UniProt: Q5F3W5
LinkDB All DBs
Position
1
AA seq 407 aa AA seqDB search
MEGWRGAWYVPCLASHETLQELCRKENLRCKSIGITNKSLKSYEVEYLCDYKVEEGKEYY
LVKWKGWPESSNTWEPQKNLKCPKLLENFLSDKDEYLSRMKEGRALKVRNSVKALKPAVA
DYIVKKAKQRIALQRWKEELNRKKNHKGMILVENTVDLEGPPIDFYYINEYKPAPGINVI
NGITTGCECSDCPAEKCCPKEAGFILAYNKQKKLKIQPGLPIYECNSFCRCGPDCPNRIV
QKGTQYSLCIFRTNNGRGWGVKTLQKIKTNSFVMEYVGEVITSEEAERRGQFYDNQGNTY
LFDLDYDSDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDLRLPRIALFSTRTIKA
GEELTFDYQMKGSIDLTSDSADGLSSSRKRIRTVCKCGAVCCRGYLN
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggagggctggcgaggagcttggtatgtgccatgtctggcttcacatgagaccctccaa
gaattatgtaggaaggaaaatctgagatgtaaatccattggaatcaccaacaagagtcta
aagagttatgaggtggaatatttgtgtgactacaaggtagaagagggcaaggaatactat
cttgtgaaatggaaaggatggccagaatcttcaaatacttgggaacctcagaaaaatctg
aaatgcccaaaacttcttgaaaactttcttagtgacaaggatgaatacttatctcggatg
aaagaaggcagagcactgaaagtgagaaacagtgttaaagctttgaaacctgcagttgca
gattacattgtgaagaaggctaaacaaagaatagctctgcagagatggaaagaagaactc
aacaggaaaaagaatcataaaggaatgattctggtagaaaacactgtggatcttgaaggt
cctcctatagacttctattacattaacgagtataagcctgctccggggataaatgtaata
aatggaataacaactggctgtgaatgctcagactgccctgctgagaagtgctgtccaaag
gaagctggttttattttggcttacaataaacaaaagaagctgaaaatccagcctggcttg
cccatctatgaatgcaattcattttgcaggtgtggtcctgactgccctaataggatagta
cagaaaggtacacaatattctctttgcatcttcagaactaacaacggccgaggctgggga
gtgaaaaccctccagaaaattaagaccaacagttttgtgatggagtatgttggagaggtg
attacaagtgaggaagcagagagacgaggccaattctatgacaaccagggaaatacgtac
ttgtttgatttggactatgactcagatgagtttacagtagatgcagctcgatatggaaac
gtgtcccactttgtgaatcacagttgtgatccaaatcttcaagtcttcaatgtattcatc
gataaccttgacttgcgtcttccgcgaatagcactgttttccacaagaaccatcaaggct
ggagaagagctgacctttgactaccagatgaaaggttcaatagatctgacttcagactct
gctgatggtctgagctcatccagaaagaggatcagaacagtctgtaaatgtggagctgtg
tgttgcagaggttatctcaactga

DBGET integrated database retrieval system