KEGG   Gallus gallus (chicken): 426812Help
Entry
426812            CDS       T01006                                 

Gene name
ALDH7A1
Definition
(RefSeq) alpha-aminoadipic semialdehyde dehydrogenase
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00010  Glycolysis / Gluconeogenesis
gga00053  Ascorbate and aldarate metabolism
gga00071  Fatty acid degradation
gga00260  Glycine, serine and threonine metabolism
gga00280  Valine, leucine and isoleucine degradation
gga00310  Lysine degradation
gga00330  Arginine and proline metabolism
gga00340  Histidine metabolism
gga00380  Tryptophan metabolism
gga00410  beta-Alanine metabolism
gga00561  Glycerolipid metabolism
gga00620  Pyruvate metabolism
gga01100  Metabolic pathways
Module
gga_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
gga_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    426812 (ALDH7A1)
   00053 Ascorbate and aldarate metabolism
    426812 (ALDH7A1)
   00620 Pyruvate metabolism
    426812 (ALDH7A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    426812 (ALDH7A1)
   00561 Glycerolipid metabolism
    426812 (ALDH7A1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    426812 (ALDH7A1)
   00280 Valine, leucine and isoleucine degradation
    426812 (ALDH7A1)
   00310 Lysine degradation
    426812 (ALDH7A1)
   00330 Arginine and proline metabolism
    426812 (ALDH7A1)
   00340 Histidine metabolism
    426812 (ALDH7A1)
   00380 Tryptophan metabolism
    426812 (ALDH7A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    426812 (ALDH7A1)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     426812 (ALDH7A1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     426812 (ALDH7A1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     426812 (ALDH7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 426812
NCBI-ProteinID: XP_424422
CGNC: 6235
Ensembl: ENSGALG00000008229
UniProt: E1C4W4
LinkDB All DBs
Position
Z
AA seq 536 aa AA seqDB search
MLGWRRAAASVLLLPRRAGWRPAAAMSSLLVGQPQYAWLRELGLQEDNPGVYNGRWGGGG
QVVTTYCPANNEPIARVRQASLEDYEETVKKAKEAWQVWADIPAPKRGEVVRQIGDALRQ
KIKVLGSLVSLEMGKIYVEGVGEVQEYVDVCDYAVGLSRMIGGPVLPSERSGHALIEQWN
PVGLVGIITAFNFPVAVYGWNSAIAMICGNACLWKGAPTTSLTSVAVTKIVAKVLEDNKI
PGAVCSLVCGGADIGTAMARDERMDLLSFTGSTEVGKQVALMVQERFGRSLLELGGNNAI
IVFEDADLNLVIPSTLFAAVGTAGQRCTTARRLFLHENIHDEVVEKLVKAYAQVRIGDPW
DSDTLYGPLHTKAAVKMFLDAVEQAKQQGGSVVYGGKVINRPGNYVEPTIVTGLAHNAPI
VHTETFAPILYVLKFKEEEEVFAWNNEVKQGLSSSIFTRDLGRIFRWLGPKGSDCGIVNV
NIPTSGAEIGGAFGGEKHTGGGRESGSDSWKLYMKRSTCTINYSKDLPLAQGIKFQ
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgctcggttggcgccgcgctgccgcctcggtgctgctgctgccacgtcgggccgggtgg
cggcccgcagccgccatgtcctcgctgctggtcggtcagccgcagtacgcctggctccgg
gagctgggcctgcaggaggacaacccgggcgtgtacaacgggcgctggggcggcggcggc
caggtggtgaccacgtactgtcctgcaaacaacgagcccatcgccagagtgcggcaggct
agtttggaggattatgaagaaacagtgaagaaggctaaggaggcgtggcaagtctgggct
gatatccctgcacctaagcgtggagaagtagtacgacagattggtgatgccctgagacag
aaaatcaaagttctaggaagcttggtctccttggaaatgggaaagatttatgttgagggt
gttggggaagtgcaggagtatgttgatgtctgcgactacgctgttggtttgtcccgaatg
attggtggacctgtcttgccttcagaaagatctggtcatgctcttatagagcagtggaat
cctgttgggttagtgggaatcatcacggcctttaacttccctgtagcagtgtatgggtgg
aacagtgcaattgcaatgatctgtggaaatgcttgtctctggaaaggtgctcccacaaca
tctctcacaagtgtagctgttacaaagatagttgccaaagtcttggaggataacaagata
cctggagctgtctgttctttggtctgtggtggagcagacattgggacagcaatggcgaga
gatgagagaatggacctgctgtctttcactggcagcacggaagtgggcaagcaggtagcg
ctcatggttcaggagagattcggccgaagtctactggaactgggaggaaacaatgccatc
attgtgtttgaagatgcagacctgaacctagtcatcccatctactttgtttgctgctgtg
ggaacagcgggtcagcgatgcacaactgccagaagactgttcctccatgaaaatatccat
gatgaggtggtggagaagcttgtgaaggcctatgcccaggtccgcatcggtgatccatgg
gattctgacactctgtatggtccccttcatacgaaagcagcagtgaaaatgtttcttgat
gcagtagaacaagcaaaacaacaaggtggctctgtggtctatggtggaaaggttataaat
cgccctggaaactatgttgaaccaaccattgtgactggccttgcccataatgcacccatt
gtccacacagagacgtttgctcccatactgtatgtgctgaaatttaaggaggaagaggag
gtttttgcctggaataatgaagtaaaacaaggtctttccagcagtatctttaccagggat
ttgggaaggatttttcgctggcttgggccaaagggatctgactgtggcattgtgaatgtc
aacatcccaacaagtggggcagagattggtggtgcttttggtggtgaaaagcacactggt
ggaggaagagaatctggaagtgattcatggaagctttatatgaaacggtcaacatgtaca
atcaactacagcaaggacttacctttggctcaaggaatcaagtttcagtaa

DBGET integrated database retrieval system