KEGG   Gallus gallus (chicken): 428320Help
Entry
428320            CDS       T01006                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease serine 9 isoform X1
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:gga01002]
    428320 (TMPRSS9)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     428320 (TMPRSS9)
Peptidases [BR:gga01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   428320 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2 Ldl_recept_a SEA
Motif
Other DBs
NCBI-GeneID: 428320
NCBI-ProteinID: XP_004948709
CGNC: 280
Ensembl: ENSGALG00000000458
LinkDB All DBs
Position
28
AA seq 1113 aa AA seqDB search
MDQIKPVLGRRGPRASCWKVTITATVVGGVTALYLGILLACHPAAETSFEHTVELRGITF
NSSLQAENSDYYRVLTPALERLFLSSFQDSQLDWSCTGCTILGYRSGNSSVIVRFRLRFA
PQDSQPLSSATEEEALRHGLAAALQEQGLSLAAFGTISSASLTAPSDVSPYRPGLKSGSC
PGDMFMCHNTQCVWKENPECDGQKDCADASDEKGCDCGSRPAMQTASRIVGGTEASRGEF
PWQVSLRENNEHFCGAAILTEKWLVSAAHCFTEFQDPAMWAAYAGTTSISGADSSAVKMG
IARIIPHPSYNTDTADYDVAVLELKRPVTFTKYIQPVCLPHAGHHFPTNKKCLISGWGYL
KEDFLVKPEFLQKATVKLLDQALCSSLYSHALTDRMLCAGYLEGKIDSCQGDSGGPLVCE
EPSGKFFLAGIVSWGIGCAEARRPGVYTRVTKLRDWILDAISPFPTSITRTVPLTHSSTN
SNVVTPEELSATTSTAIPTSSPALAASKPATAPRPQECGGRPGLSKPNKIVGGTDASRGE
IPWQVSLQEDSMHFCGATIIGDRWLLSAAHCFNETNPEEIEAYMGTTSLNGTDGSAVKVN
VTRVIPHPLFNPMLLDFDVAVLELARPLVFNKYIQPICLPLAVQKFPVGKKCIISGWGNL
QEGNVTMSESLQKASVGIIDQKTCNFLYNFSLTERMICAGFLEGKIDSCQGDSGGPLACE
VTPGVFYLAGIVSWGIGCAQAKKPGVYSRITKLNDWILDTISQFPGPSTGAPSTSATART
TADILTLRPSTTATGPISETTPSEKAATTVQETSTALKSTEPAKPTQAPVVPCTSLTFRC
SSNICIGKENPECDGVVDCSNGFDESNCDCGLTTALAFSKIVGGSSAARGEWPWQVSLWL
RQKEHKCGAVLIADRWLLSAAHCFDIYSDPKMWVAFLGTPFLNGNDGKMEKIFRIYKHPF
YNVYSLDYDVALLELSAPVRFSSTIKPICLPDNSHIFQEGARCFITGWGSTKEGGLMTKH
LQKAAVNVIGDQDCKKFYPVQISSRMVCAGFPQGTVDSCSGDAGGPLACKEPSGRWFLAG
ITSWGYGCARPHFPGVYTKVTAVQGWIAQNLKL
NT seq 3342 nt NT seq  +upstreamnt  +downstreamnt
atggaccaaataaagccagtgctgggcagaaggggaccgagggccagctgctggaaggtg
accatcactgccactgtagtgggcggtgtgacagccctctacctggggatcctgctggcc
tgtcatcctgcagcagagaccagctttgagcacacagtggagctgcgagggatcacgttc
aacagcagcttgcaggcagagaactcagactattaccgggtgctgacgcccgccctcgag
aggctgtttctgtccagtttccaggactcccagctggactggagctgcactggttgcacc
atcctgggctacaggagtgggaactcgagtgtcattgtccgcttccgcctccgcttcgct
ccacaggactcccagcccctcagctctgccacggaggaggaggcactccgacatgggctc
gcggccgcactgcaggagcaaggcctctccctggccgccttcgggacgatatcctcagct
tctcttacagctcccagtgatgtttctccatacagaccaggactgaagtcagggagctgc
cctggtgacatgttcatgtgccacaacacgcagtgcgtgtggaaagaaaaccctgaatgt
gacggccagaaggactgcgccgacgcctctgatgaaaagggctgcgactgtgggagccgc
cctgccatgcagactgccagcaggatagtcggaggcacagaggcatccagaggggagttc
ccctggcaggtcagcctgcgagagaacaacgagcatttctgtggtgctgcaatcctcacg
gagaagtggctggtgtctgctgctcactgctttaccgagttccaggacccggccatgtgg
gcagcgtacgcagggaccacctccatcagtggtgcagacagcagtgcagtgaaaatgggc
atcgcccggatcatccctcacccctcctacaacactgacacggccgactacgacgtggcc
gtgctggagctgaagagacccgtgaccttcactaagtacatccagcccgtgtgcctgcca
catgctgggcatcacttccctaccaacaagaagtgcctgatctctggctggggatacctc
aaggaggatttcttggtgaaacctgagttcctgcagaaggcaacggtaaagctgctggac
caggcgctgtgctccagcctctacagccatgccctcacagacaggatgctgtgtgctggt
tacctggaggggaaaattgactcctgccagggggactccggtgggccgctggtttgtgaa
gaaccatctggcaagtttttcctggcaggaatcgtgagctggggaataggatgtgctgaa
gccaggcggccaggggtttacacacgcgttaccaaactgagagactggatcttggatgct
atttctccctttcccacctccataacacgcaccgtcccactaacacactccagtactaac
agtaacgtggtcacacctgaagaactcagcgccaccaccagcacagcaatccccacctct
tcaccagccctggctgccagcaaaccagcaactgcacccagaccacaagagtgcggagga
cgacctggcctatctaaacccaacaagattgtgggaggaaccgatgcttccagaggggag
atcccctggcaggtcagcctgcaggaagactcgatgcatttctgtggggcaacgatcatt
ggggaccgctggctgctgtcagctgcgcactgcttcaacgagacaaatccggaagagatt
gaagcctacatgggaacgacatcactaaatggaacagatgggagcgcagtgaaagtcaat
gtaacacgagtgatcccgcatcctctcttcaaccccatgcttctggactttgatgtagct
gtacttgagctggcaagacccctcgtcttcaacaaatacatccagcccatctgcctccct
ctcgctgtgcagaagtttcctgttggcaagaaatgcataatttctgggtggggaaacctc
caagaagggaatgtcaccatgtctgagagcctgcagaaagcctctgtgggcatcatagat
cagaagacctgcaacttcctctacaacttctccctcactgagcggatgatctgcgctggt
ttcctggaggggaagattgactcatgccagggagattcaggagggcccttggcctgcgag
gtcaccccgggcgtgttttatctggctggcatcgtgagctggggaattggatgtgcccag
gccaagaaacctggcgtgtactccagaattaccaaactcaacgactggatcctggatacc
atctcgcagtttcccggtcccagcacaggcgctccttccacttcagccaccgccagaact
actgcagatatcctcacgctccgtcccagcacaacagctacaggtcccatcagtgaaacc
accccgagtgagaaggctgccaccaccgtgcaagaaacctccacagctctgaaatccact
gagcctgccaagcccacccaggccccagtggtgccttgtaccagcctcaccttcaggtgc
tccagcaacatctgtattggaaaagaaaatcccgaatgcgacggagttgttgactgcagc
aatggctttgatgagagcaattgtgactgcggcttaaccactgctctggccttcagcaag
atcgtgggtgggagctctgcagctcgaggagaatggccctggcaagtcagtctctggctt
cggcagaaggagcacaagtgtggggctgtcctcattgccgacaggtggctgctttctgca
gctcactgctttgatatttacagtgaccccaaaatgtgggtggcctttctgggaacgccc
ttcctgaatggcaacgatggcaaaatggagaaaatattccgtatctacaagcaccctttt
tacaacgtctacagcctggactacgacgtggcgctgctggagctgagcgcgcccgtcagg
ttcagcagcaccatcaaacccatctgtctcccagacaactcacacatcttccaggaagga
gccaggtgcttcatcacaggctggggctccaccaaggaaggaggcctcatgacaaagcac
ctgcaaaaagcagcagtgaatgtgattggagaccaggactgcaaaaagttctatcctgtc
cagatcagcagcaggatggtgtgtgctggtttcccgcagggtaccgtcgacagttgctca
ggtgatgcaggtgggcccctggcatgtaaagagccctctggacggtggtttctagcaggg
atcacaagctggggctacggctgcgccaggccgcacttccctggggtctacaccaaagtc
acggcggtgcagggctggatcgcgcagaacctcaagctctga

DBGET integrated database retrieval system