KEGG   Gallus gallus (chicken): 430516Help
Entry
430516            CDS       T01006                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
gga  Gallus gallus (chicken)
Pathway
gga03030  DNA replication
gga03410  Base excision repair
gga03420  Nucleotide excision repair
gga03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    430516 (LIG1)
   03410 Base excision repair
    430516 (LIG1)
   03420 Nucleotide excision repair
    430516 (LIG1)
   03430 Mismatch repair
    430516 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:gga03032]
    430516 (LIG1)
   03400 DNA repair and recombination proteins [BR:gga03400]
    430516 (LIG1)
Enzymes [BR:gga01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     430516 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     430516 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     430516 (LIG1)
DNA replication proteins [BR:gga03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    430516 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     430516 (LIG1)
DNA repair and recombination proteins [BR:gga03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     430516 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     430516 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     430516 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 430516
NCBI-ProteinID: XP_015156079
CGNC: 53965
Ensembl: ENSGALG00000043938
LinkDB All DBs
Position
31
AA seq 775 aa AA seqDB search
MQRRITSFFAPPRAADGAVPAHVQKLERRPPEETPQERRDPDGSADAASPGSSSAPVPPT
SPRAPCCPPSPQQSGDRDGDSDRDSGSPASKRCRQSPSDQDKGPPPPCKSPAPNSHIPVE
PSQYDPSRSGYHPVQDACWGHGRSVPYLAVARTFERIEEASSRLKIIEILTNLLRSVVAL
SPSELLPCLLLCLNRPGAPSEGLELGIGETLLTRALAQATGRQLAQIRSEAQDKGDLGLV
AESSRCTQRTVVPPAPLSASGVLGKLREMAAMSGNASASKKIDIIKGLFVACRHSEARYL
VRSLSGKLRIGLAEQSVLTALAHAIALTPPGQEWPLAVVDAGQSMAPDARRTWLEEQSRI
LKQTFCELPDYAAIVPVLLEHGLEQLPKHCGITPGVPLKPMLAQPARCVSELLKRFEEAA
FTCEYKYDGERTQIHVLESGAVFIYSRNQENTTSKYPDLVQRIPKMLKPGVRSCILDAEA
VAWDKVTKQLQPFQVLMTRKRKDVDAAAIKVQVCVYAFDLLYLNGEPLVREPLATRRQLL
RQSFEEVEGEFLFATSMDTRSADEVSDFLDKAIKASCEGLMVKTLEVEATYEIAKRSHKW
LKLKKDYLDGLGDTLDLVVIGAYLGKGKRAGIYGGFLLACYDEESEEYQSICKIGTGFTE
ESLEKHYNFLKEHVLTQPRPYYRWDNAVAPDRWLAAVQVWEVKCGDLSISPVYRAAVGLV
DEDKGISLRFPRFLRVRGDKKPEEATSSTQVAELYKKQQQIQNQQQAEKGDEEFY
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atgcagcggcggatcacgtctttcttcgccccccccagggctgcagatggcgccgtccca
gcgcatgtgcagaagctggagcggcgccctcccgaagagaccccccaggaacgtcgggac
cccgatgggagcgcggatgccgcatcccctggcagcagctctgcccctgtaccccccaca
tcccctcgtgccccctgctgtcccccctccccacagcagtcaggggacagggatggagac
agtgatagggacagtggctcccctgcatccaagcgctgccgtcagtcacccagtgaccag
gacaagggacctccccctccctgcaaatctccagcccccaacagccatataccggtggag
ccatctcagtatgaccccagcaggagtgggtaccacccagtgcaggatgcgtgctggggg
catggacgcagtgtcccctacctggcggtggctcgcaccttcgagcgcatcgaggaagcc
tcatcccggctgaagatcattgagatcctcaccaacctcctgcgctccgtggtggccctg
tccccctccgaacttctcccctgccttcttttgtgcctcaaccgtcccggagccccctct
gaggggctggagctgggcatcggcgagaccctgctcacccgtgcccttgcccaggccact
ggccgccagctggctcagatccgcagtgaagcacaggataaaggggatttggggctggtg
gccgaaagcagccgctgcacccaacgcacggtggtgccaccggccccgctgagtgccagt
ggtgtccttggcaagctgcgggagatggctgccatgtcaggcaatgcgtctgctagcaag
aagattgacatcatcaagggactgtttgttgcctgccggcactcagaggcacgatacctc
gtccgatcgctcagtgggaagctacgcattgggctggctgagcagtcggtgctcactgca
ctggcacacgccattgctctcaccccaccagggcaagagtggccgctggctgtggtggat
gctgggcagagcatggcacctgatgcacgtagaacttggttggaggagcagagccgcatc
cttaagcagactttctgcgagctgccagactatgctgccattgtcccggtgctgctggag
catggcctggagcagctccccaagcattgcggcatcactccaggtgttcccttgaagccc
atgctggcccaacctgcccgctgcgtcagtgagctgctgaagcgctttgaggaggctgca
ttcacctgcgagtacaaatatgatggagaacgaacccagatccacgttctggagagcgga
gccgtcttcatctacagccgcaaccaggagaacacaacctccaagtaccctgacctcgtc
cagcgcatccccaagatgctgaagcccggtgtgcgttcgtgcatcctggatgcagaagcg
gtggcttgggacaaggtcaccaagcagctgcagcctttccaggtgctgatgacgaggaag
aggaaggatgtggatgctgctgccattaaggtgcaagtgtgcgtctatgcctttgatctg
ctatacctcaatggggagccactggtgcgggagcccttggccacacgacgtcagttgctg
cgacagtcattcgaggaagtggagggtgaattcctctttgccacctcaatggacactcgc
agtgctgatgaggtctctgatttcctggacaaagccatcaaggcctcctgcgagggtctc
atggtaaagacactggaggtggaagccacctacgagattgcgaagcggtcccataagtgg
ctgaagctgaagaaggactacctggatggccttggggacacgctggacctcgttgtcata
ggtgcctatctgggcaagggcaagcgtgcaggcatctatgggggcttcctgctggcctgc
tatgacgaggagagtgaggagtaccagagcatctgcaagataggcactggtttcactgaa
gagagcttggagaaacactacaacttcctcaaggaacatgtgttaactcaaccgcgtccc
tattaccgctgggacaacgcagtggcccccgaccgttggctggcagctgtgcaggtctgg
gaggtgaaatgtggggacctctccatttcccctgtctacagggcagctgtggggctggtg
gatgaggacaagggcatctcgctgcgcttcccacggttcctgcgtgtgcgcggggacaag
aaacctgaggaggccaccagcagcacgcaggtggccgagctctacaagaagcagcagcag
atccagaaccagcagcaggcagagaagggggatgaggagttctattga

DBGET integrated database retrieval system