KEGG   Gallus gallus (chicken): 769230Help
Entry
769230            CDS       T01006                                 

Gene name
PCSK1
Definition
(RefSeq) neuroendocrine convertase 1
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:gga01002]
    769230 (PCSK1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:gga03110]
    769230 (PCSK1)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     769230 (PCSK1)
Peptidases [BR:gga01002]
 Serine Peptidases
  Family S8: subtilisin family
   769230 (PCSK1)
Chaperones and folding catalysts [BR:gga03110]
 Intramolecular chaperones
  Subtilisin family
   769230 (PCSK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain Proho_convert Peptidase_S8_N
Motif
Other DBs
NCBI-GeneID: 769230
NCBI-ProteinID: XP_003643108
CGNC: 55088
Ensembl: ENSGALG00000014681
UniProt: F1NB95
LinkDB All DBs
Position
Z
AA seq 748 aa AA seqDB search
MDGPRRAGRCAALALLAACCLARGGGAERQFLNEWAAEVPAGPDAARAIAEELDYDLVGQ
IGSLKNHYLFRHKSHPRRSRRSAIHITKRLSDDERVSWAEQQYEKKRTKRAAVTDSAENL
FNDPMWNQQWYLQDTRITPSLPKLDLHVIPVWQKGITGRGVVITVLDDGLEWNHTDIYAN
YDPRASYDFNDNDYDPFPRYDPTNENKHGTRCAGEIAMQANNRKCGVGVAYNSKVGGIRM
LDGIVTDAIEASSIGFNPEHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGIKQGRNGKG
SIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATAYSSGDY
TDQRITSADLHNECTGTHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPL
AGNPGWKKNGAGLMVNSRFGFGLLNANALVDLADPKRWKGVPEKRECIVQDKSFEPRLLR
ANEEVIIEIPTKACEGQENSIASLEHVQLEATIEYSRRGDLHVTLVSPSGTSTVLLAERE
RDKSPNGFKNWDFMSVHTWGENPTGTWVLRITDVSKRIQNEGRIVNWKLILHGTDTQPEH
MKQPRVYTSYNAVQNDRRGVEKMTDLAEDHTTQENLSEKNKVTQDIGSSRNKAEDKFPSE
AMLHLLRSAFSRQMAQKRLPKKTASEKLSIPYEHFYQALEKLNKPSQLKDSEESLYSDYV
DLFYNAKPYKHRDDRLLQALVDIINEGN
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atggacgggccccgccgagccggccggtgcgcggccctggcgctgctggccgcctgctgc
ctggcccgcggcggcggcgccgagcggcagttcctcaacgagtgggcggccgaggtcccg
gcgggccccgacgccgcgagagccatcgccgaggagctggactacgacctcgtggggcag
attgggtcgctcaaaaatcactacctgttcagacataagagccacccacggcggtcccgg
agaagtgccattcacatcaccaagaggctttctgatgacgagcgggtgtcatgggcagag
cagcagtatgaaaaaaagcgaactaagcgtgctgctgtgacagactcggcagagaatctc
ttcaatgatcctatgtggaatcagcagtggtatctgcaagatacaagaataactccatct
cttcccaaactggatctccacgttattcctgtgtggcaaaaagggattacaggcaggggt
gttgtcatcacggtattagatgatggcttggagtggaatcacactgacatctacgccaac
tatgatccaagggcaagttatgatttcaatgacaacgactacgatccatttcctagatat
gacccaacaaacgaaaacaagcatggaacacggtgtgcaggagaaattgccatgcaagcc
aacaatagaaaatgtggagttggagtagcctacaattctaaagttggaggtatacgcatg
ctggatggaatagtcactgatgctattgaagccagttcaattggtttcaatccggaacac
gtggatatttacagtgcaagctggggcccgaatgacgacggtaaaactgttgagggacct
gggagactggcacagaaagcttttgagtatgggataaaacagggccgaaatggaaaaggc
tccatttttgtgtgggcttccgggaatggaggtcgtcagggtgacaactgtgactgtgat
ggttacactgatagtatctacactatctccattagcagtgcttctcagcaaggcctttct
ccctggtatgcagagaagtgctcttcaaccctggccacagcatacagcagtggggattat
actgaccaaagaataacaagtgctgatcttcacaatgaatgtacagggactcacactggg
acctctgcatctgcaccattggcagcaggaattttcgctcttgctctggaagcaaaccca
aatttgacatggagggatatgcagcacttggtagtgtggacctcagaatatgatccattg
gctggcaatccaggatggaagaagaatggagcaggactaatggtgaacagccgatttgga
tttggactactcaatgcaaatgcactggtggatttagctgatcccaaaagatggaaaggt
gtaccagaaaagagagagtgtattgtccaagacaaaagctttgaaccaaggttattaaga
gcaaatgaagaggtcatcattgaaattcccacaaaagcctgcgagggtcaagagaactca
attgcatctctggagcatgtgcagcttgaagcaacaattgaatattcccggagaggagat
cttcacgtcactctggtgtctccgtcagggaccagcaccgtcttactggctgagagagag
cgagataaatctcccaatggctttaagaactgggatttcatgtctgtgcacacatgggga
gagaatccaacaggcacctgggtgttaagaattactgatgtgtccaaaagaatacaaaat
gaaggaaggattgtaaactggaaattgattttgcatggcactgatacccagcctgaacat
atgaaacaaccacgtgtatacacatcttacaatgctgtgcaaaatgacagaagaggagtg
gagaagatgacagaccttgcagaggaccataccacacaggagaacttgagtgaaaaaaac
aaagtaacacaagatatcggtagcagcagaaacaaagcagaagataagttcccatcagag
gctatgctgcatttactgcgaagtgcttttagcagacagatggctcagaagcgactgcca
aagaagactgcaagtgagaagttaagtattccatatgaacacttctatcaagccctcgaa
aagctaaacaagccctcccagctgaaagactcggaagaaagtctgtacagtgactatgtt
gatcttttttacaatgccaaaccatacaagcatagagatgacagactgctgcaagccttg
gttgatattataaatgaaggaaactag

DBGET integrated database retrieval system