KEGG   Gallus gallus (chicken): 769701Help
Entry
769701            CDS       T01006                                 

Gene name
TUBGCP6
Definition
(RefSeq) LOW QUALITY PROTEIN: gamma-tubulin complex component 6
  KO
K16573  gamma-tubulin complex component 6
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    769701 (TUBGCP6)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    769701 (TUBGCP6)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    gamma-tubulin ring complex
     769701 (TUBGCP6)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Gamma-tubulin complex components
     769701 (TUBGCP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GCP_C_terminal GCP_N_terminal DUF4573
Motif
Other DBs
NCBI-GeneID: 769701
NCBI-ProteinID: XP_025000157
CGNC: 55462
Ensembl: ENSGALG00000032156
LinkDB All DBs
Position
1
AA seq 1753 aa AA seqDB search
MESITQLFNDLCEAHLTGLPWKVHLGRQKISKRKAKQNLKRVAYNTLFINLFQDEARKLQ
SNISRLPVKNKILMLSFNLRVGGLGAQADRLESLVEELEQAEGLPFTEVNAVLDLLVQLA
GTGPPQLVPQKKDYFLNNKYVGRNVKYQGYDYYDVSVFEADIQSLITNEECQFNDTIQKT
LQIMEAAPGTGLPAIGLFSQNYPAGDKFERETRVSLFGALVHSRTYDMDIKLDLPPVPDN
ADLSGLAIKVPQSIDQSEDEGFQSASNLTPDSQSEPSMTPDIDLWDAVLTYGPSKRRCWE
RIGYPPGKKEEPYLTEAGREAFDKFYKLREGEMQLFSSTALQLPQLVLMREPELVKDVLN
VLIGVVSTTFSLNQAAQTFIIKEGVYVSGTSPETMHNLLSEVAEYGTYYTRLSRFSLQPV
LDSSYSKGLVFQAFTSGLRKYLQYYRACVLSTPPTLSLLTISFLFRKLGRQLRYLAELCG
IGITALGISGGAGASFPTGVKLLSYLYKEALNNCSNEHYPVLLSLLKTSCEPYTRFIYDW
VYSGVFRDVYGEFMIQVNEDYLCFRDKHYWTHGYVLISKEVEDCVPVFLKHIANDVYICG
KTINLLKLCCPRHYICWSDIPVPRISVIFSLEELKEIERDCAVYVGRMERIARYSSISKE
EKDLRMEIAKQELIVHARETASKVLQAINDRQKSERLALDAKKREQFQKLKEQFAKDQER
RLAXKQEEIDDDFSYARELREREKRLKALEEELEKKARQELIDHYSKLSDDAARREQRAL
WKIQRHKLETARLKFLFEDQKRIEEMLEKLPDGSYRRKLDIIPYNSASWLWIETLLWKIH
IHRFAVSSVKPLRSNEKVGRKESESGLENITSTDKPLAMPQLANTNADQLCQPKTAGSEC
SLQSSEQVCSPLCNADSSPESSVNIEDFLPKPQDEQPVAISLQGSLLDEALRNINSDLSE
TSPMSENQPVSEEGNTLLHQQNEYDFNTVLRPTAALQGHIRVGENVFDVEPRRPRWNIHG
HASDASIRVGEYVPEVDTYQPRSSPYGHSSDSHIEISSYTSEVESTRPRWNIHGHASEAH
IKIGEYASEVEPSRPRWSIHGHASEANIRVGEYVSNVAPARPRWNIHGHVSDANIKIGEN
VSEVVSARPRWNIHGHSSQSHIKIGELVSDTQPVKSRWSPFGHASHSSIQIGKWTPSTED
DPIPHRKAISGPSSDSTVQTLLYNEELSPSEEIRKETKPSQAKESISPQSQPSDIDPVSP
DTRDDKKENTTKRSKKVSVIAVFNLFVIVVIAGEVDKDPSPDSSQSLQAKEPEKAIPQDT
VPQEALFSEPSASKTKDEEGGEEDAWKKEQAYLKALSDQYCIEKYQDSYDLMSELPVSHL
LHHVIPRSYTFPVDPMVQSATDETAVQLSELLSLPVLMKRSITAPLVSHVSLVNKAIVDY
YFVELNVEKHFEALRHFLLMEDGEFAQSLSDLLFEKLGSGQTPGELLNPLVLNSILNKAL
QYSLHGDTQLASNLSFALKYLPEVFKPNAPDALSCLELRYKVDWPLNIVITESCMNKYNK
IFSFLLQLKHMVWTLKDVWFHLKRTALVSHASNSVQFRQLQLYKHEMQHFVKVIQGYIAN
QILHVTWCEFGNKLSSVGNLEEIHRTHAEYLNKAIFRGLLTEKAAPVMNIIHSIFSLILK
FRSQLISQSWSFDAGKQMAVHPNFGLMQQSYNTFKYYSHFLFKVVTKLVNRGYQPHLEDF
LLRINFNNYYKDN
NT seq 5262 nt NT seq  +upstreamnt  +downstreamnt
atggagagcattacacaactgttcaatgacctgtgtgaggcacacctgacgggtttgcca
tggaaggtgcacctgggcaggcagaagatcagcaagaggaaggctaagcaaaacctgaag
agggttgcatataatactctgttcataaacctttttcaagatgaagctcgtaagctgcaa
tcaaacatttccaggcttccagttaaaaacaagattttgatgctgtcttttaacctgagg
gtcggtggcctaggagcccaggcagacaggctggagagtcttgtggaggagctggaacaa
gccgagggcttgccatttactgaggttaatgctgtcctggatctcttggtacagcttgct
ggaacaggtcctccacagcttgtaccacaaaaaaaggactattttctgaacaacaaatac
gtcgggagaaatgtcaagtatcagggttatgattattacgatgtaagcgtgtttgaagct
gatatacagtctctaataacaaatgaagaatgtcaattcaacgacacaattcagaagacg
cttcagatcatggaggctgcccctggaacaggactccctgccataggactgttctcacag
aactatcctgctggggacaagtttgagagagaaacacgcgtctcactctttggtgctctt
gtccacagccgtacttatgacatggacatcaagttggatttgccaccagtgcctgacaat
gcagatttgtctggacttgcaattaaagttcctcaaagcatagaccagtcagaagatgaa
ggattccagtcggcatccaatctgactcctgattctcagtcagagccaagcatgactcca
gacatagatctgtgggacgcagtgcttacatatgggccgagcaaacgaagatgctgggaa
agaattggatacccacctgggaaaaaggaagagccgtaccttactgaggctgggagagaa
gctttcgacaagttctacaaactccgagaaggggaaatgcagctcttcagtagtactgct
cttcagcttccacagctcgtgctgatgagggaacctgaactggtgaaggatgtcttgaat
gtcctcattggtgtggtatccactacattttcactcaatcaggctgctcagacatttata
ataaaggagggggtttatgtgtctggaacttcgccggagacaatgcacaacctgctctca
gaagttgcagaatatggaacctactacacacggctgagtcgcttctctctgcagccagtc
ttagattcttcatacagcaaagggctcgtgtttcaggctttcacaagtggtctgagaaag
tatcttcagtattaccgagcctgtgttttgtctactcctcctactttaagtcttctgaca
atcagctttctcttcaggaaattgggtcgtcagttgagatacctggctgaactttgtggc
ataggaataacagcactggggatcagtggcggagctggtgcttcttttcctacgggtgtg
aaattgctttcatatctgtacaaagaagccctcaacaactgtagcaatgagcattatcca
gtccttctgtctttgttgaaaacaagttgtgaaccatacacaagatttatctacgattgg
gtatacagtggtgtattcagggatgtttacggagagttcatgatccaggtgaatgaggat
tatctgtgtttcagagataaacattactggactcatggttacgtcttgatttcaaaagaa
gtagaagattgcgtccctgtatttcttaaacatattgctaatgacgtatatatatgtggg
aaaaccataaacctgctgaaattgtgttgtcccaggcattacatatgttggtcggatata
cctgtaccccggatttctgttattttttcactcgaggagctgaaagaaatagagagagat
tgtgcagtgtatgtaggtcggatggaaagaattgctcggtacagttctataagcaaggag
gaaaaggatttgcgcatggaaatcgccaagcaagaattaattgttcatgctcgagagact
gctagcaaagtactacaagccattaatgatcggcagaaatcggaacgactggctttagat
gcaaagaaacgtgaacagtttcagaagttgaaagagcaatttgcaaaagaccaagagcgt
cgccttgctnataagcaagaggagattgatgatgatttcagctatgcccgagagctcaga
gaaagagaaaaaagactgaaagctttggaagaggaactagaaaaaaaggcaaggcaggag
ttaattgaccattacagcaaactttctgatgatgcagcccgtagggaacaaagagcttta
tggaagatccagcgacataagttggaaacagctcgtcttaagtttctttttgaagatcag
aaacgtatcgaggaaatgcttgaaaaacttccagatggaagctacaggagaaaattagat
attataccttacaacagtgccagctggctttggatagaaacactgctgtggaagatccac
attcacaggtttgctgtgtcatctgtgaaacctttgcgttctaatgaaaaagttggcagg
aaggaatctgaatctggactggaaaacattacatctactgacaaaccattggccatgcca
cagctggcaaatactaatgctgatcagctttgtcagcctaaaactgcagggtctgaatgc
agtctgcagagttcagagcaagtgtgcagtcccctatgcaatgctgattcctctcctgaa
tccagtgtgaacatagaagatttcttaccaaagccacaagatgaacaacctgttgccatt
agcttacaaggatctctgctagatgaagcacttagaaatattaactcagatctgtcagag
acttctccaatgagtgaaaatcagcctgtctcagaagaaggtaatacactgttacatcag
caaaatgagtatgattttaatactgttctcaggccaactgctgctttgcaggggcacatt
agagttggagaaaatgtatttgatgtggagcctagaaggcctcgatggaacatccatggg
catgcatctgatgccagcattagagtgggagaatatgtgcctgaggtggacacttatcag
ccacgttcaagtccttatgggcattcttcagattcccatatagaaatcagcagctatact
tcagaagttgaatctactcggccccgatggaatattcatggacatgcttctgaagctcat
attaaaattggggaatatgcttcagaggtagagccctcaagacctaggtggagcattcat
ggacacgcttcagaagccaatattagggttggtgaatatgtgtcaaatgttgctcctgca
aggcctcggtggaacatccatggtcatgtgtctgatgccaatattaagatcggtgagaac
gtgtcagaggttgtctcagctagacctcgttggaacatccatgggcattcttcacagtca
cacatcaaaattggagagctggtttcagatacacagcctgtgaaatctcgttggagcccg
tttggtcatgcatcccactcaagcattcaaatagggaaatggactccatctacagaggat
gatcccatacctcatcgtaaagcaatttctggtccttcatctgattccacagttcagaca
cttctatataatgaagaattatctccttctgaagagattagaaaggaaacaaaaccatca
caagctaaggaaagtatttcaccacagtcacagccatctgacattgatcctgtctctcct
gacactagagatgacaaaaaggaaaatacaacgaagagaagcaagaaggtctcagtaatt
gctgtctttaatttatttgtaattgtagtaattgcaggtgaggttgacaaggacccttct
ccagattcatcacagagcttgcaggcaaaagaacctgaaaaagcaattccacaggatact
gtgcctcaagaagctttattttctgaacctagtgcttcgaagactaaggatgaggaaggg
ggagaggaagatgcatggaagaaagaacaagcttatttgaaagcattatcggatcagtac
tgtatcgaaaagtaccaagatagttacgatttgatgtcagaactaccagtttcccatctc
ttgcaccatgtgattccaagatcatacacttttcctgtggatcctatggtgcagtcagca
acagatgaaacagctgtacaactgagcgagctcctctctctgcccgtgctgatgaaacgt
tctattactgctccactggtatctcatgtctctcttgtgaacaaagcaatagttgattac
tactttgtggaactgaatgtagagaagcattttgaagcactgagacacttcctgttaatg
gaagatggggagtttgctcagtcgctcagtgacctgttgtttgagaagcttggatcagga
cagacgcctggtgaactgctgaatccgctggtgcttaactctatcctaaacaaagcatta
cagtacagtcttcatggtgacacccagcttgcttccaatctttcttttgccctcaagtac
cttccagaagtgttcaagcccaatgcacctgatgctctgagctgcttagagctaaggtac
aaggttgactggcctctgaatattgtcataacggagagctgcatgaataaatacaacaag
atcttctccttcttgcttcagttgaagcacatggtgtggactctaaaggatgtgtggttt
cacttaaaacgcactgcattagtgagtcatgcatcaaattctgttcagttccgacagctc
cagctatataaacatgaaatgcagcattttgtgaaagttattcaaggttacattgctaat
cagattcttcatgttacgtggtgtgaatttggaaacaaactgtcttctgtgggcaatttg
gaagaaattcacagaacacacgctgagtacctcaacaaagcaatcttcaggggtctgttg
actgagaaggctgccccggtgatgaacatcatacacagcatcttcagcctcatcctgaag
ttccgcagccagctgatctctcagtcgtggagctttgatgctgggaagcaaatggccgtt
catcccaactttggtttgatgcagcagtcatacaatactttcaagtattactctcacttc
ttattcaaagtggtaacaaagctcgtaaatagaggataccagccacatttggaggacttc
ctactgcgaatcaactttaataactactacaaggataactga

DBGET integrated database retrieval system