KEGG   Gallus gallus (chicken): 771136Help
Entry
771136            CDS       T01006                                 

Gene name
TGM6L
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 6-like
  KO
K05624  transglutaminase 6 [EC:2.3.2.13]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    771136 (TGM6L)
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     771136 (TGM6L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 771136
NCBI-ProteinID: XP_015152172
CGNC: 56540
LinkDB All DBs
Position
20
AA seq 696 aa AA seqDB search
MAELKPTHISWQPSVNASAHHTDRYANTELTVRRGQPFTITLYFNRQKYPGESLAFVTEI
GPSPSESHRTRAVFNLSEVGASGWSAAQGPSESGYMTFIISSPANAIIGRYNLILQVNSG
NKIFSRFLGQFVLLFNPWCPGDDVYIANENERQEYVLNENGIIFVGNAKYIEARGWYYGQ
FQDHLLNICLTMLDLSLYYRQDPAVDVSRRGDPKYVGRVISSMINGNDNDNGVLLGKWQG
SFHSHENPSRWDGSVVILQKWRQDNYKPVQYGQCWVFAGVMCTVLRCLGIPTRLVSNFNS
AHDVDRNLSIDKYYDSSGKSLNISKDSTWDYHVWNESWFIRPDLGPRYNGWQVLDATPQE
QSRGLFQCGPASVVAIKEGDVDLDYDTLFVYTEVNADCNRWIVYNDGTKKRVYCDTEIIG
RFISTKAVGSNSRVDITCNYKYPEGSPEERRVYKKALAKIFGSHITEGHTTSSHERSSEA
MRNPGISGKFKLAEPPVFGKDINLILILNNLSTDHKTVKVDISASSVLYTRRAVAEILKA
NTSVDLGSKQGKHIRLKIPYAYYGKYLTTDKRIQVTALCEVMHMHGVKLLVEKTIILEDT
NIIIKIPRRVVVNKAATLEISYANPLPEPVDRCVLLVTLMNQQVKIHLARLAPRERSRIY
FEFTPRRTGPLQLQVDFSCDKFSHVKGFVTIAVQPA
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atggcagagctgaaaccaacacatattagctggcagccttcagtaaatgcaagcgcacac
catactgacagatatgccaatactgagttgactgtgaggcgtggacaacccttcactatt
actctatacttcaacagacaaaagtaccctggggagagcctagcctttgtcactgaaata
ggaccatccccctcagaatctcatcgtacaagggctgtgtttaacctctctgaggtggga
gcaagtggttggagtgctgcccagggacccagtgagtctggatatatgacctttataata
tctagcccagctaatgccatcattggacgatacaatctcatcctccaggtaaactcaggg
aacaagatcttctccagattcctggggcagtttgtgcttcttttcaatccttggtgccca
ggtgatgatgtgtacatagctaatgaaaacgagagacaggagtacgttctaaatgaaaat
ggaattatctttgtgggcaatgcaaagtacattgaagcaagaggatggtactatggacag
tttcaagatcacctcctaaacatctgtctcaccatgcttgatctgagtctatactatcgt
caggatccagctgttgatgtatctcgaagaggagatcctaaatatgtgggccgagtcatc
agttctatgatcaatggaaatgataatgataatggagttctcctgggaaagtggcaagga
agtttccattcacatgagaatccatccagatgggatggcagcgtagtaatcctacagaaa
tggcgtcaggacaactacaagcctgttcaatacggccagtgctgggtgttcgcaggtgtg
atgtgtacagttctgagatgcttggggattccaactcgtttggtttccaattttaactct
gcccatgatgtggatagaaacctgagcatcgataagtactatgacagctctggaaaaagt
cttaatatcagcaaggattcaacatgggattatcacgtctggaatgaaagctggttcatt
cgcccagatctgggaccacgatacaatggatggcaggttttagatgcgactccacaggaa
caaagcagaggattattccagtgtggccctgcatctgtcgtagccatcaaagaaggtgat
gtagacctggattacgacaccttatttgtgtatacagaagtgaatgctgattgcaacaga
tggattgtatacaatgatggaactaagaaaagagtttactgtgatactgaaataattggc
aggtttatcagcaccaaagctgttggcagcaattcccgtgtggatatcacctgtaactac
aaatatccagaaggctctcctgaggaaagaagagtttacaagaaggccttagccaagata
tttggatcacacatcacagaaggacacaccacttcctcacatgaaagatcttcagaggca
atgagaaaccctgggatctctgggaagttcaagctggctgaacctccagtgtttggcaaa
gacattaacctcatcttaattctcaataacctatccactgaccacaagactgtgaaagtg
gacatcagtgcatcaagtgtcctgtacaccaggagggcagtagcagagatcctgaaagca
aacacctctgtggatcttggttctaagcaagggaaacatatccggttaaagatcccttat
gcttattatgggaaatacttgactactgacaaaaggatccaagttactgctttgtgtgaa
gtcatgcacatgcatggcgttaagctgctggtggagaagacaatcattttagaggacaca
aacattatcattaagattcctcgtcgggttgtagtgaacaaagctgcaactctagagatc
tcctacgccaatccgctccctgaacctgtggaccgctgtgtactcctggtgactttgatg
aatcaacaggtcaagatacatctagcacgactggcaccaagggagagatcaagaatttat
tttgaattcacaccccgcaggactgggcccttacagctgcaagtagacttctcttgtgac
aaattttcacatgttaagggttttgtaaccattgcagtacaacctgcataa

DBGET integrated database retrieval system