KEGG   Geobacillus sp. GHH01: GHH_c02440Help
Entry
GHH_c02440        CDS       T02455                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ggh  Geobacillus sp. GHH01
Pathway
ggh00473  D-Alanine metabolism
ggh00550  Peptidoglycan biosynthesis
ggh01100  Metabolic pathways
ggh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ggh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GHH_c02440 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GHH_c02440 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    GHH_c02440 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ggh01011]
    GHH_c02440 (ddl)
Enzymes [BR:ggh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     GHH_c02440 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:ggh01011]
 Precursor biosynthesis
  Amino acid ligase
   GHH_c02440 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST GARS_A
Motif
Other DBs
NCBI-ProteinID: AGE20827
UniProt: L7ZUT1
LinkDB All DBs
Position
229069..230172
Genome map
AA seq 367 aa AA seqDB search
MKTRVGVLYGGKSPEHQVSLSTAMAVMNAIDPHKFDVIPIYITPEGQWIKGKQLTGPIEE
IKQLQFTSAATALIPVSLNQVPAADSAAGGNEETIDVIFPLLHGPNGEDGTVQGLLEILN
IPYVGNGVLASAVGMDKVMMKNLFAQAGLRQAKYIAVTKYDWQKRGETVYDRIERELGYP
CFVKPANAGSSVGISKCKQRGDLKAAFIEAFQYDRKIIIEEAIVGREIEIGVIGNDEPIC
SVVGEIVPKKEFYDYEAKYEDGQTELIIPADVTKEQYETIKQMAITAFQALDLSGLARVD
FFLAEDGAVYINEVNTMPGFTPYSMFPLLWQHSGVPYPELIERLIALALERHQEKQTITY
TFKKEKR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgagagttggcgtgttatacggcggcaaatcaccggagcaccaagtatcgttg
tcgacggcgatggcggtgatgaacgccattgatcctcataaattcgatgtcattccgatt
tatattacaccggaaggtcaatggatcaagggcaaacaactgaccggaccgatcgaggaa
atcaagcagctgcaattcacttcggcggcgaccgccttgattccggtttccttgaaccaa
gttccggctgccgattcggctgcgggaggaaacgaggaaacgatcgatgtcattttcccg
cttttgcatgggccgaacggtgaagacggaacggtgcaagggctgcttgagatattgaac
attccgtatgtcggcaacggggtgcttgcttccgcggtcggcatggataaggtgatgatg
aaaaacttgtttgcgcaggccgggttgcgccaagcaaaatatatcgccgtgacgaagtac
gattggcaaaaaagaggcgagacggtgtatgaccggatcgaacgagagcttggctacccg
tgctttgtcaagccagccaacgccggttcgagcgtcggcatttccaaatgcaagcagcgc
ggcgatttaaaagccgcatttatcgaggcatttcagtatgaccgaaaaattattattgaa
gaggcgattgtcggccgcgaaattgaaatcggcgtgatcggaaatgatgagccgatttgt
tcggtcgttggcgaaattgttcccaaaaaggaattttacgactatgaagcgaaatacgaa
gacgggcaaaccgaattgatcatcccagcggacgtaacgaaagaacagtatgagacgatc
aaacaaatggccattacggcgtttcaggcgctggatttgtctggacttgcgcgcgtcgat
tttttcctcgccgaagatggcgctgtttatatcaacgaagtgaacacgatgccaggcttt
acgccatacagcatgttcccgcttctttggcagcacagcggtgtgccgtacccggagctg
attgaacggcttatcgcgctcgcattggaacgacatcaagaaaagcagacgatcacgtac
acgttcaaaaaagaaaagaggtga

DBGET integrated database retrieval system