KEGG   Geobacillus sp. GHH01: GHH_c03520Help
Entry
GHH_c03520        CDS       T02455                                 

Definition
(GenBank) YhgE1-like protein
  KO
K01421  putative membrane protein
Organism
ggh  Geobacillus sp. GHH01
Brite
KEGG Orthology (KO) [BR:ggh00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    GHH_c03520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane_3 DUF3533 ABC2_membrane KASH_CCD ApoLp-III DUF3450 Tektin STAT_alpha Laminin_I Spc7 Laminin_II COG5
Motif
Other DBs
NCBI-ProteinID: AGE20917
UniProt: L7ZV17
LinkDB All DBs
Position
complement(345460..347769)
Genome map
AA seq 769 aa AA seqDB search
MHAFQLWLKEWKAILSNRKVLIPVIAVLFIPLLYSGMFLWAFWDPYDHLDELPVAVVNQD
KGAVLNGKEIHLGEDLVEKLKENKQFDWHFVTEHEGEKGLKEQKYYMLIQIPDDFSRNAT
TLQDDHPKKLQLIYKPNEGFNFLSAQIGETAVEKIKNEVANAITETYAESMFDTIQTVAD
GLTNASDGAAQLHDGLSQAQDGTNRLYDGMKKAQDGTETLYHHLATLAEKSVSFTDGLHQ
AASGSLQVQTGSEALYNVMKQMTAGQEKLLSGAKQAQQGAANLASGTRRVYEGMQALDAR
TPQLLQGSEQLSDGAAKLTASLAQWQEGAEQVHTGAAQITSGLEQLGAQLDVLIKTTPQA
QQRAVYEQLKEQIMKLSSGSQQVENGLAQLNSGAQSLHSGASSLHEGAQQLHEGHIALDR
GVDELLAGQQQLVNGADALANGQEQLVSGMKTMYDKMQEAAQGASQLAHGSGTLSSGLQT
LAQGADQLQDGTRQLRDGSQQVAAGTKELTNGTKHLQDGVNQLTDGSKELADKLKEGAEQ
ASDVKANKAVYDMFAQPVNLHKEEINKVPNYGTGFTPYFLSLGLFVGALLLSIVFPLREP
AEIPRSPLHWFLAKFGILIGIGILQALLADVVLLVGLDLHVKSVPLFIVFSIVTSITFLS
VIQFLVTVFGDPGRFIAIVVLILQLTTSAGTFPLELIPRSLQHFNAWLPMTYSVFGLKAV
ISSGDFSFMWENIGKLLLFVVAMMMGTLVYLTIQHRRQFATAVEQASEA
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcatttcaattatggttaaaagaatggaaggccattctgtccaaccgcaaagtg
ctgattcctgtcatagctgtattattcatccctcttctatacagcggcatgtttctatgg
gcattttgggatccatacgatcatttggatgaacttcccgtcgctgtagtcaaccaagac
aaaggggcggttctcaacggcaaagagattcatcttggggaagatcttgtcgaaaagtta
aaagagaacaagcagtttgactggcattttgtaaccgaacatgaaggggaaaaagggtta
aaagaacaaaagtattatatgctcattcaaatccctgacgatttttcccggaatgcgaca
acgctgcaagacgatcatccgaaaaaactgcagctcatttacaaaccgaatgagggattt
aactttctatcggcacaaatcggcgaaactgcagttgaaaaaataaaaaacgaagtagcg
aacgccataacagaaacatatgccgaaagcatgtttgatacgattcaaactgtcgctgac
ggattgacaaacgcgagcgacggagccgcacaactgcatgacggactcagccaagcacaa
gacggaacaaaccgactgtatgatggcatgaaaaaagcacaagacggaactgaaacgtta
tatcaccatttagcgacactcgcggaaaaatccgtgagctttactgacggactgcaccaa
gctgccagtggctcattgcaagttcaaaccgggtccgaagcgctttacaacgtgatgaaa
cagatgaccgctgggcaagagaaactcctctccggagcaaagcaggctcagcaaggagca
gcgaatcttgcttcagggacaagacgcgtatatgagggaatgcaagcgctcgacgcccgc
actccgcagcttttgcaaggatctgaacaattgagcgatggagcagcaaagctcacagct
tcattggctcagtggcaggaaggagccgaacaagttcacacaggtgcggcccaaatcaca
agcggtcttgagcagttgggcgcgcagctggacgtgctcatcaagacaactcctcaagcg
caacagagagccgtatatgagcaattaaaagaacaaatcatgaaactatcatcgggaagc
cagcaagtcgaaaacggccttgcgcagttaaatagcggcgcccaatcgttgcactctgga
gcctcttctttgcacgaaggagcccaacagctgcatgaagggcacatcgctctcgatcgc
ggagtcgatgaactgcttgccggtcaacaacaacttgtcaatggcgcagacgcactggcg
aatggccaagaacaactcgtcagcggcatgaaaacaatgtatgacaaaatgcaagaagct
gcacaaggagcaagccagcttgcccatggcagtggaacactttcttcaggcctgcaaaca
ttggctcaaggagcggatcagcttcaagatggtacgcgccagttgagggacggttcacaa
caagtagcggctggaacgaaggaattaacgaacgggacaaaacatttgcaagatggtgtc
aaccaactgacagacggctcgaaagaattggcggataaattgaaagaaggagccgaacaa
gcaagcgatgtcaaagccaataaggctgtctacgacatgtttgcccaaccagtgaatctc
cacaaggaagaaatcaataaagtgccgaactacggaacagggtttacgccgtacttctta
tcacttggattgtttgtcggagcgctgttgctttccatcgtctttccgcttcgcgaacca
gcggagattccgcgttcaccattgcattggtttttggctaaattcggcatcttgatcggc
atcgggattttgcaagcactgctggcggatgtcgtgttgctggttggactcgatttacac
gtaaaaagcgtcccgctctttatcgtgtttagcattgtcactagcatcacatttttatct
gtcattcaatttcttgttaccgtgttcggcgatccaggaagatttatcgcgattgtcgtg
ctgattttgcaattgacaacaagcgcgggaacattcccgctcgaactgattccacgctcg
ttgcaacactttaacgcatggcttccgatgacgtattcggttttcggattgaaagcggtc
atctcaagcggtgatttctcgtttatgtgggaaaacatcggcaagctgcttctatttgtt
gttgccatgatgatgggaacactcgtttatttgactatccaacatcgccgccaatttgcc
acggccgtcgaacaagcttctgaagcgtaa

DBGET integrated database retrieval system