KEGG   Geobacillus sp. GHH01: GHH_c03950Help
Entry
GHH_c03950        CDS       T02455                                 

Definition
(GenBank) putative aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
ggh  Geobacillus sp. GHH01
Pathway
ggh00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:ggh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GHH_c03950
Enzymes [BR:ggh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     GHH_c03950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AGE20960
UniProt: L7ZTE3
LinkDB All DBs
Position
398132..399613
Genome map
AA seq 493 aa AA seqDB search
MKIQNYINGEWKEPSTGQFAPVINPATGETIAEVAMSGPNDIDEAVQAAKEAQRQWALVP
APKRAEVLYRVGMLLKERKEQLARLLTMEMGKVIEEARGEVQEGIDMAFYMAGEGRRLFG
DTTPSELKDKFAMSVRTPVGVVGIITPWNFPIAIATWKSFPAIVAGNAVVWKPAPETPIM
AQELARIFEEAGLPPGVFHVVHGDGPTVGNALVEHPDVKVISFTGSNEVGRMIAEKCGRL
LKKVSLEMGGKNAVIVMDDADLTLAVDGIIWSAFGTSGQRCTACSRVIVHERVKQELERR
LLEAVKALKIGNGLDETVKVGPVIHEEALQKIDRYVRIGVEEGAKLLVGGYILREGDYAR
GFYYAPTIFTDVTPNMRIAREEIFGPVVSIMSVRSLDEAIAVNNSVDYGLSSAIFTRDVN
HVFRAMRDLDTGIVYVNAGTTGAEIHLPFGGTKGTGNGHRDSGVAALDVFTEWRSIYVDF
SGKLQRAQIDTDD
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatccaaaactatatcaatggagaatggaaggagccaagcaccgggcaatttgcg
ccggtgatcaatccggcgacgggggaaacgattgccgaggtggcgatgtccgggccaaac
gatattgacgaggccgttcaagcagccaaagaagcgcaaagacagtgggcgctcgtgccg
gcgccgaaacgcgcggaagttttatatcgagtcggcatgctgctaaaggagcggaaagaa
caattggcacggctgttgacgatggaaatgggcaaagtgattgaggaagcgcgcggcgaa
gtgcaggaaggcattgatatggcgttttatatggcgggggaagggcggcggctgttcggc
gatacgacgccgtctgaactgaaagacaaatttgccatgagcgtccgcacgccggttgga
gtggtcggcatcatcactccatggaattttcccattgccatcgcaacgtggaagtcgttc
cccgcgattgtggccggcaatgcggtcgtatggaagccagcgcccgagacaccgatcatg
gcgcaggaattagctcgcatttttgaagaagcgggcttgccgccgggagtgtttcatgtg
gtccacggtgacgggccgacagtcggcaatgcgctcgtcgagcatcctgatgtcaaggtc
atctcatttaccggatcgaatgaagtcgggcggatgattgcggaaaaatgcggacggctg
ttgaaaaaagtgtcgctcgaaatgggtgggaaaaacgcggtgatcgtcatggatgatgcc
gatttgacattggcggttgacggcatcatctggagtgcgttcggcacatcaggccagcgg
tgcacggcgtgcagccgggtcatcgtccatgagcgggtgaaacaggagcttgagcggcgt
ctgcttgaagccgtgaaagcattgaaaatcggcaacgggttggatgaaacggtcaaagtc
ggacccgtcatccatgaagaggcgctgcaaaaaatcgaccgctacgtgcgcattggcgta
gaagaaggggcgaaactgcttgtgggtggctatatattgcgcgagggcgactatgcgcgc
ggcttttattacgcgccgacgattttcaccgatgtcacgccgaatatgcgcatcgcccgc
gaagaaattttcggcccggttgtatcgatcatgtccgtccgcagtttggacgaagcgatc
gccgtcaacaacagcgtcgattatgggctgtcaagcgccattttcacacgcgatgtcaac
catgtattccgagcgatgcgcgatttggacaccggcatcgtgtatgtcaacgccggcaca
acgggagcggaaattcatttgccgtttggcggcacgaaagggacgggcaacggccaccgc
gactccggcgtcgctgcgcttgacgtcttcaccgaatggcggagcatttatgtcgatttc
agcggcaagctgcaacgggcgcaaatcgataccgatgattga

DBGET integrated database retrieval system