KEGG   Geobacillus sp. GHH01: GHH_c11020Help
Entry
GHH_c11020        CDS       T02455                                 

Gene name
prkC
Definition
(GenBank) serine/threonine-protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ggh  Geobacillus sp. GHH01
Brite
KEGG Orthology (KO) [BR:ggh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ggh01001]
    GHH_c11020 (prkC)
Enzymes [BR:ggh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     GHH_c11020 (prkC)
Protein kinases [BR:ggh01001]
 Serine/threonine kinases: Other
  Bacterial family
   GHH_c11020 (prkC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Kinase-like APH Kdo Seadorna_VP7 RIO1 FTA2 PIP49_C Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: AGE21640
UniProt: L7ZVC5
LinkDB All DBs
Position
1075959..1077929
Genome map
AA seq 656 aa AA seqDB search
MLIGKRLNDRYKIISLIGGGGMANVYLARDIILERDVAVKVLRLDFANDDQFIKRFRREA
QAATSLNHEHIVSIYDVGEEEGVYYIVMEYVRGATLKQYIQQHAPLPVERALGIMDQLTS
AIAHAHENGIIHRDIKPQNILLDEHGNVKVTDFGIAVAMSGTTITQTNSVLGSVHYLSPE
QARGGIATEKSDIYSLGIVMFELVTGRLPFSGESAVSIVLKHLQAETPSPKAWNPDIPQS
VENIILKATAKDPFYRYQSAREMNEDIRTALDPRRRNEPKFTIPDDDEEATKAIPMIKHA
ESAALEQETLVYEEKTSEPVHTTGEPKPKRKRVWIAWLVAALLFIGAAGVSAVTWIPDLI
FPKEVTMPNVVNKNYDDAVEQLSSLGLEIKDTIDVEDDQIEEGKVVRTDPEAGMTVKKGA
GVIIYKSIGKKKIEFPSFIGDDIAAAEEELRAEGFTRITRNGRHSDKPEGTILDQYPYAG
DRVAPDETEVIFTVSLGPEKVTVKDLTGYTEKSVRDYGADQGLRIDVKYEYSDEVPEGLV
ISQTPAANEQVKKGETITVVISRGPEPKPSKTVVKEIMIPYEPAMPGQMVEAQLYIQDAN
HNMSTPYKTYRLTAPATEMVEFEIPYGETAYYRVIVNNVVKEEGSIPYPEHNEKKG
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
gtgctcattggaaagcgattgaatgaccgctataaaatcatcagccttatcggcggcggc
ggcatggcgaatgtctatttggcccgcgacatcattttggagcgcgatgtcgccgtgaaa
gtgctccgccttgattttgccaatgatgatcagttcatcaaacggttccgccgcgaggcg
caagcggcgacgagcttaaaccatgaacatatcgtctccatttatgacgtcggcgaagag
gaaggcgtctattacatcgtcatggaatatgtgcgcggcgcgacgctgaagcaatacatc
cagcagcacgctccgcttccggtcgaacgggcgcttggcattatggaccagctgacatca
gcgatcgcccatgcccatgagaacggcatcatccatcgcgacattaaaccgcaaaacatt
ttgcttgatgagcacggcaatgtgaaagtgaccgacttcggcatcgctgtggcgatgagc
ggcacgacgatcacgcagaccaactcggtgctcggttcggtccattatttgtcgccggag
caggcgcgcggcggcattgccaccgaaaagtcggacatttattcgcttggcatcgtcatg
tttgaacttgtcaccggtcggctgccgttttccggcgaatcggccgtttcgatcgtgctg
aagcatttgcaggcggaaacgccgtcgcccaaggcgtggaaccccgacattccgcaaagc
gtcgaaaatattattttaaaagcgacggcgaaagacccgttttaccgctaccaatccgcg
cgcgaaatgaacgaggacattcggacagcgctggatccaaggcggcgcaacgagccgaaa
tttaccatacccgatgacgatgaggaagcgacgaaagccattccgatgatcaaacatgcg
gaaagcgcggcgttggagcaagagacgcttgtgtacgaggaaaaaacgagcgaaccggtt
catacgacgggcgaaccgaaaccaaagcggaaacgggtatggattgcctggcttgtggct
gccttgctgttcattggagctgccggcgtcagcgcggtcacatggattccggacctcatt
tttccaaaagaagtgacgatgccgaacgtggtcaacaaaaactatgatgacgctgttgaa
cagctgtcgtcgctcggtttggaaatcaaagatacgattgatgtggaagatgatcaaatc
gaagaaggaaaagtcgtgcgcaccgatccggaagccggcatgacggtgaagaaaggggcc
ggcgtcatcatttataaaagcattggaaaaaagaaaatcgaatttccaagcttcattggc
gatgatattgctgcggcggaggaggagctgcgcgctgaaggattcacccgcattacgcgc
aatggccgccacagcgacaagccggaagggacgattttggatcaatacccgtacgccggc
gatcgagtggcgcctgatgaaacggaagttatctttaccgtcagcctcgggccggagaag
gtcaccgttaaagatttgactggctatacggaaaaaagcgtgcgcgactacggcgcggat
caagggttgcgcattgacgtgaagtacgagtattcggacgaggtgccagaagggcttgtc
atttcgcaaactccagcggcgaacgagcaggtaaaaaaaggggaaaccatcacggtcgtc
atttcccgcgggcccgagccgaagccgtccaaaacggtagtgaaagagattatgatcccg
tatgaaccggcgatgccggggcaaatggttgaagctcagctttacatccaagatgccaac
cacaatatgtcaacgccatacaaaacataccggctgacggcgccagcgaccgagatggtc
gagtttgaaattccatatggggagaccgcttattaccgcgtcattgtcaacaatgtcgtc
aaagaggaaggatcgatcccgtacccagaacataacgaaaaaaaggggtga

DBGET integrated database retrieval system