KEGG   Geobacillus sp. GHH01: GHH_c12790Help
Entry
GHH_c12790        CDS       T02455                                 

Gene name
glpF
Definition
(GenBank) glycerol facilitator
  KO
K02440  glycerol uptake facilitator protein
Organism
ggh  Geobacillus sp. GHH01
Brite
KEGG Orthology (KO) [BR:ggh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ggh02000]
    GHH_c12790 (glpF)
Transporters [BR:ggh02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    GHH_c12790 (glpF)
Ion channels [BR:ggh04040]
 Non-ion channels
  Aquaglyceroporins or glycerol-uptake facilitators
   GHH_c12790 (glpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP Sbt_1
Motif
Other DBs
NCBI-ProteinID: AGE21817
UniProt: L7ZXN2
LinkDB All DBs
Position
1252687..1253505
Genome map
AA seq 272 aa AA seqDB search
MSPFLGEFIGTALLIIFGAGVCAGVNLKKSYAANSGWIVITMGWGLAVAVAVYAVGRYSG
AHLNPALTVALAISGDFPWKDVPGYVLAQVLGAMVGAAVVYLHYWPHWKETDDPGVKLGV
FATGPAVPNTAANLLSEIIGTFVLVLAILAIGANKFADGLNPFIVGFLIVAIGLSLGGTT
GYAINPARDFGPRLAHFLLPIPGKGSSNWAYAWVPIIGPLLGGALGSLVYKAVFLGKPSA
ALWGVLAATAVVLAAPKMTKGKTVSAASRRSL
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccatttttaggggaattcatcggtacggcactgctcatcattttcggcgctggt
gtgtgcgccggggtcaatttaaagaaatcatatgcggccaattcgggctggattgtcatt
acgatggggtgggggctggcggtggccgtggccgtatacgctgtcggccggtatagtggc
gcccatctcaatccagcgctgacagtggcattggccataagcggcgattttccatggaaa
gatgtccctggctatgtgttggcacaagtacttggcgctatggttggggctgccgtcgtc
tatctccactattggccgcattggaaggaaacagacgacccgggtgtcaagcttggcgtg
tttgcgacgggtccggccgtgccgaatacggctgccaacttgcttagcgagatcatcgga
acgtttgtgttggttttggccatcttggccattggcgccaacaaattcgctgatgggctc
aatccatttatcgttggttttttgatcgtggcgattggactgtcgctcggcggtacgacg
ggatacgccattaatcccgctcgagactttgggcctcggttagctcactttttgttgcca
atcccagggaaagggtcatcgaattgggcgtatgcgtgggtgccgatcatcgggccgctg
cttgggggtgcgttaggcagtttggtctataaagccgttttcttgggaaaaccgtcagcc
gcattatggggagtgctggcggcaaccgcagtcgttttggcggcgccgaagatgacaaaa
ggaaagacagtgagcgccgcaagccgccgttctctctag

DBGET integrated database retrieval system