KEGG   Geobacillus sp. GHH01: GHH_c25340Help
Entry
GHH_c25340        CDS       T02455                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ggh  Geobacillus sp. GHH01
Brite
Enzymes [BR:ggh01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GHH_c25340 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N AHSP
Motif
Other DBs
NCBI-ProteinID: AGE23045
UniProt: L7ZZC8
LinkDB All DBs
Position
complement(2529963..2530577)
Genome map
AA seq 204 aa AA seqDB search
MPFELPALPYPYDALEPHIDKETMNIHHTKHHNTYVTNLNAALEGHPDLQNKSLEELLSN
LEALPESIRTAVRNNGGGHANHSLFWTILSPNGGGEPTGELAEAINKKFGSFTAFKDEFS
KAAAGRFGSGWAWLVVNNGELEITSTPNQDSPIMEGKTPILGLDVWEHAYYLKYQNRRPE
YIAAFWNIVNWDEVAKRYSEAKAK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgccatttgaattgccagcattgccgtatccgtacgatgccctggagccgcacatcgac
aaagaaacgatgaacattcaccacacgaagcaccataacacatacgtgacaaatttgaat
gcggcgcttgaagggcatccggatttgcaaaacaaatcgctcgaagaattgctcagcaat
ttggaagcccttccggaaagcattcgcacggcggtgcgcaacaacggcggcggccatgcg
aaccactcgcttttctggacgattttgtcgccaaatggcggcggtgagccgacaggtgag
ctggctgaggcgatcaacaaaaaattcggcagcttcaccgcgtttaaagacgagttttcg
aaagcagcggctggccgtttcggttctggttgggcatggcttgtcgtgaacaacggcgag
ctggaaattacgagcacgccgaaccaagattcgccgattatggaaggcaaaacgccgatt
ctcggcttggacgtttgggagcatgcgtactacttgaaataccaaaaccgccgtccggaa
tacattgccgcattctggaacattgtcaactgggacgaagtggcgaaacggtacagcgaa
gcgaaagcgaagtaa

DBGET integrated database retrieval system