KEGG   Geobacillus sp. GHH01: GHH_c27480Help
Entry
GHH_c27480        CDS       T02455                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ggh  Geobacillus sp. GHH01
Pathway
ggh00020  Citrate cycle (TCA cycle)
ggh00190  Oxidative phosphorylation
ggh00650  Butanoate metabolism
ggh01100  Metabolic pathways
ggh01110  Biosynthesis of secondary metabolites
ggh01120  Microbial metabolism in diverse environments
ggh01130  Biosynthesis of antibiotics
ggh01200  Carbon metabolism
Module
ggh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ggh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ggh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GHH_c27480 (sdhB)
   00650 Butanoate metabolism
    GHH_c27480 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    GHH_c27480 (sdhB)
Enzymes [BR:ggh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     GHH_c27480 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     GHH_c27480 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_10 Fer4_9 Fer4_16 Fer4_17 Fer4_2 Fer4 Fer4_18 Fer4_4 Fer4_13 Fer4_21 Fer4_15 Fer4_3
Motif
Other DBs
NCBI-ProteinID: AGE23259
UniProt: L8A152
LinkDB All DBs
Position
complement(2739725..2740486)
Genome map
AA seq 253 aa AA seqDB search
MSENKTVRFIITRQDRPDSAPYEEEFVIPYRPNMNVISALMEIRRNPVNAKGEKTTPVAW
EMNCLEEVCGACSMVINGKPRQACAALIDKLEQPIRLEPMRTFPVIRDLVIDRSRMFDAL
KRVKAWIPIDGTYDLGPGPRMPERKRQWAYELSKCMTCGVCLEACPNVNSKSNFIGPAPL
SQVRLFNAHPTGAMHKAERLRAIMGDGGLANCGNSQNCVQSCPKGIPLTTSIAALNRETT
IQMFRDFFGSDEV
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaacaaaacggttcgattcatcatcacccgtcaagatcgtccggattctgct
ccgtatgaagaggagtttgtcattccgtaccgcccgaacatgaacgtcatttcggcgctc
atggaaattcgccgcaatccggtcaacgccaaaggggaaaaaacgacgccggtcgcttgg
gaaatgaactgtctggaagaagtatgcggagcctgttcgatggtcattaacggcaaaccg
cgccaggcgtgcgccgcactcattgacaaactcgagcagccgatccgccttgagccgatg
cgcacattccctgtcatccgcgacttggtcatcgaccggagccggatgtttgatgcgttg
aagcgagtgaaagcatggattccgatcgacggaacgtacgacttgggcccggggccgcgc
atgccggagcggaagcggcaatgggcgtacgagctgtccaaatgcatgacgtgcggcgtc
tgcctggaagcgtgcccgaacgtcaacagcaagtcgaactttatcggcccggcgccgctg
tcgcaagtgcggctgtttaacgcccatccgaccggggcgatgcataaagccgaacggttg
cgggcgattatgggcgacggcggactggccaactgcggcaactcgcaaaactgcgtgcaa
tcgtgcccgaagggcattccgttgacgacatcgatcgcggcgttaaaccgcgaaacgacg
attcaaatgttccgcgatttctttggcagcgacgaagtgtag

DBGET integrated database retrieval system